KEGG   Shewanella baltica OS223: Sbal223_2010Help
Entry
Sbal223_2010      CDS       T00803                                 

Definition
glucan 1,4-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
sbp  Shewanella baltica OS223
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sbal223_2010
Enzymes [BR:sbp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Sbal223_2010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2371771..2374347)
Genome map
AA seq 858 aa AA seqDB search
MESSPTPQQDLHTSQTRHAQTLTRRSRLALAVAASLLGTIGFTACSPTSNSATPSMSGNA
ASNVQLVAPGAPGKAPTWAFSGKTGIGTSYEPYTQGQYQDAKQNPISRVWFSLAQGILTE
TMYGLIHNAQLKELQFVITGNGFVDTEKDNTISSIEYLDTDANGRPQSLAYKIINKDIEG
KYQIEKHIFTDPDRDTLMMRVTFTAFEDGITPHLYVNPHIDNAGANDIGRIDTNTDNHTN
THAGNQALVAYTAAKDSSVMTVKSELNFVQATTGFVGVSDGLADLADNGTLDTPYQTTSA
QDKSTVGNIAFTASYPTLIKAKPVTFNLAIGFGKDETQSLANADATLAAGYDAVLSAYKG
DATHVGWHDYLSSLPAIANMANNTTDSGKLLYTSAMVLKAQEDKTYAGALIASLSNPWGD
TVSAAVPSTGYKAVWPRDFYQCAMAFLAMGDTQTPKVAFEYLEKVQVTEMTPGFTGTPGW
FLQKTHVDGQIEWVGVQLDQTAMPIMLGWKLWQAGVLTPDEISHWYQEMLKGAADFLISG
GEVNLDWNHTQIAPPKTQQERWEEQAGYSPSTTAAVIAGLVAASEIANEAKDPDSSSRYL
AAAKDLSNSLEKHLVTTQGLLKNSAGVSAPYYLRLSPNGEPNTADTLAANNGKQGLDQRQ
ILDGGFLELVRYGVRGATDKLINQSLQLIDNTELDSNLRLKYEFTAKDGSKIPGFRRYGN
DGYGEDTVSGKNYAESGSNSADQRGRVWPFFTGERGHFELALAQEKGELTGNNSQQTKQH
LINTYVQGMETFANAGMMLPEQAWDGVGDATRYHYQLGQGTNSATPLAWTHAEYIKLVRS
MTDGQVWDNYPIVPAALK
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgagtcctacgccgcagcaggatctgcacactagccaaacccgtcacgcacaa
acgttaacaaggcgcagccgcctagcgcttgccgtcgccgcaagtctattagggacaata
ggattcactgcttgttcacccacatcgaattcagcaacaccaagcatgagtggcaatgcc
gcatcaaatgtgcagctggttgcgcccggcgcaccgggtaaagcaccgacttgggcattt
tcgggtaaaaccggtattggaacgtcgtacgagccttacacccaaggtcaataccaagat
gccaagcagaatcctattagccgcgtttggttctccctcgcccaaggtattttaaccgaa
accatgtatggtcttattcacaatgcgcagctcaaagaactgcaatttgtgatcacggga
aatggctttgtcgatacagaaaaagataacaccatcagcagcatagaatatttagataca
gatgctaatggtcgcccacaatcccttgcctataaaattatcaataaagatattgaaggt
aagtatcagattgaaaagcatatctttaccgatcctgaccgcgacaccctaatgatgcgc
gtcacctttaccgcctttgaagacggcattacgccgcatttgtatgtcaatccgcatatc
gataacgcgggcgccaatgatatcggccgcatcgacactaatacagacaatcataccaac
acacatgctggcaatcaggcgctggtggcctataccgccgccaaagacagcagcgtgatg
acggtcaaatccgagctgaattttgtgcaggcaacgacaggctttgtcggtgtctccgat
ggcctagccgatttggccgataacggcacactcgatacgccctatcaaacgaccagtgcg
caagataaatcgaccgttggcaatatcgcctttactgcgagttaccctacgctcatcaaa
gccaaacccgtcacttttaatctcgccatcggttttggtaaagatgaaacccagagttta
gccaatgccgatgccactttggccgcaggttatgatgctgtgctgagcgcctataaaggc
gatgccacccatgtcggctggcacgattacttaagctcgctgcccgccatcgcaaacatg
gccaacaacaccacagatagcggtaagctgctgtataccagtgctatggtcttgaaagcg
caggaagataaaacctatgcgggcgcacttatcgcctcgttatccaatccttggggcgat
acggtttcagcagccgtgccgagtactggctataaagcggtatggccgcgtgacttttac
caatgtgccatggcattcctcgccatgggtgacacccaaacgcccaaagtggccttcgaa
tacctggaaaaagtgcaagtgaccgaaatgacgcccggctttacgggtacgccgggttgg
ttcctgcaaaagacccatgtggatggccaaattgagtgggttggtgtgcagctcgatcaa
accgccatgcctatcatgctcggctggaaactctggcaagcgggtgtgctcacccctgat
gagatcagtcactggtatcaagagatgctcaaaggtgctgcagacttcttgatcagtggc
ggtgaggtcaatctggattggaatcacactcaaatcgccccgccaaaaacccagcaagag
cgttgggaagaacaagcgggttactcaccctcgaccacggccgcagtgatcgcaggtctt
gttgccgcgagtgaaatagccaatgaagccaaggatcccgactccagcagccgttatctt
gccgccgccaaagacttaagtaatagtttagaaaaacacttagtcaccacccaaggacta
ctaaaaaacagcgcaggcgtcagcgcgccttactatttacgtttaagcccgaatggcgag
ccaaacaccgccgatacactggcggcgaataacggtaagcaaggtttagatcagcgtcag
atcctcgatggcggatttttagaactagtacgttatggcgtgcgcggtgcaactgataag
ctgatcaatcaaagccttcaattgattgataacactgaacttgactctaatttgcgcctt
aaatatgagtttaccgctaaagatggcagcaaaatcccaggctttagacgttatggcaac
gatggctacggtgaggatacggtttctggcaagaactatgcggaatcgggcagcaacagc
gccgatcaacgtggccgcgtctggcccttcttcaccggtgagcgcggtcattttgaatta
gcactcgcccaagaaaaaggcgagctaacaggcaataactcgcagcaaaccaagcagcat
ttgatcaacacctatgtgcaaggcatggaaacgtttgcgaatgcgggcatgatgttaccc
gagcaagcgtgggacggtgtcggcgatgccacccgctaccattaccaactcggacaaggc
actaactcagccacgccgctagcctggacccatgccgaatacattaaactggtgcgctca
atgaccgacggccaagtctgggataactaccctatcgtcccagcggcattgaaataa

DBGET integrated database retrieval system