KEGG   Shewanella baltica OS223: Sbal223_2092Help
Entry
Sbal223_2092      CDS       T00803                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
sbp  Shewanella baltica OS223
Brite
Enzymes [BR:sbp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Sbal223_2092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2479280..2480308
Genome map
AA seq 342 aa AA seqDB search
MPSTAENKELDSAAQILRLAVPQMSALDIPVTPENYTVWYEYFAGTNLDLNRAIDGFLAN
SVSFTKEVNTSLYKNFIQEQSPEVIENVQIETQILINSLLSKISQLSQGTAAFSGSLAEF
GLRLQTNPDINTLNELVDGVVDEMQMLLINNREMEQSLCTMGQEVQNLKSEMENLSLAAM
TDQLTSLHNRRAYELSIQDQIYLSQDHQTRCSLLLIDIDNFKAFNDTYGHLTGDKVLAYV
ALALKQCVRGDDFVARYGGEEFVVVLPNTHFHDALQVAENLRERISERRLTIGKDKKLSL
GAITVSIGLASLQQGDDAETLFSRADKALYQAKAEGRNCVRG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccttctactgcagaaaataaagagcttgattctgccgcgcaaattttgcgtttggcc
gtaccgcaaatgtctgccctcgatatccccgttacacctgaaaactacactgtttggtat
gaatattttgcagggacaaatctcgatttaaaccgtgcgattgatggctttctggcaaat
tcggtctcttttactaaggaggtcaataccagcctgtataagaactttattcaagaacag
tcacccgaagtgattgaaaatgtgcagattgaaacgcaaatcctgatcaatagtttgtta
agtaaaatcagccagttgagtcaaggcaccgcggcgttttcaggttcattagccgagttt
ggtttacgcctacagacgaatcccgacattaataccttaaacgagctggttgacggtgta
gtcgatgaaatgcagatgctactcatcaacaaccgtgagatggagcaaagcctgtgcacc
atgggccaagaagtgcaaaatcttaaatctgaaatggaaaacctgagtctggcagcgatg
acggaccaattaacctcgctgcataatcgccgtgcctatgaactgagtattcaagatcaa
atctacctctcccaagatcatcaaacccgttgcagccttttactgatcgatatcgataac
tttaaagcctttaacgacacttatggccatttaaccggcgataaagtgttagcctatgtc
gcattagccttaaaacaatgtgtgcgaggggatgactttgtggcgcgctatggcggcgaa
gaatttgtggtggtgttgcctaacactcattttcacgatgcattacaagtggctgaaaat
cttcgggaacgtatctctgagcgccgcttaaccataggaaaagacaaaaaactttccctt
ggcgccattactgtttcgattggtctggcttcattgcagcaaggcgacgatgcagaaacc
ctattcagtcgcgccgacaaagcgctgtatcaagctaaggccgaaggccgtaactgcgtg
agaggataa

DBGET integrated database retrieval system