KEGG   Shewanella baltica OS223: Sbal223_2092Help
Entry
Sbal223_2092      CDS       T00803                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
sbp  Shewanella baltica OS223
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2479280..2480308
Genome map
AA seq 342 aa AA seqDB search
MPSTAENKELDSAAQILRLAVPQMSALDIPVTPENYTVWYEYFAGTNLDLNRAIDGFLAN
SVSFTKEVNTSLYKNFIQEQSPEVIENVQIETQILINSLLSKISQLSQGTAAFSGSLAEF
GLRLQTNPDINTLNELVDGVVDEMQMLLINNREMEQSLCTMGQEVQNLKSEMENLSLAAM
TDQLTSLHNRRAYELSIQDQIYLSQDHQTRCSLLLIDIDNFKAFNDTYGHLTGDKVLAYV
ALALKQCVRGDDFVARYGGEEFVVVLPNTHFHDALQVAENLRERISERRLTIGKDKKLSL
GAITVSIGLASLQQGDDAETLFSRADKALYQAKAEGRNCVRG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccttctactgcagaaaataaagagcttgattctgccgcgcaaattttgcgtttggcc
gtaccgcaaatgtctgccctcgatatccccgttacacctgaaaactacactgtttggtat
gaatattttgcagggacaaatctcgatttaaaccgtgcgattgatggctttctggcaaat
tcggtctcttttactaaggaggtcaataccagcctgtataagaactttattcaagaacag
tcacccgaagtgattgaaaatgtgcagattgaaacgcaaatcctgatcaatagtttgtta
agtaaaatcagccagttgagtcaaggcaccgcggcgttttcaggttcattagccgagttt
ggtttacgcctacagacgaatcccgacattaataccttaaacgagctggttgacggtgta
gtcgatgaaatgcagatgctactcatcaacaaccgtgagatggagcaaagcctgtgcacc
atgggccaagaagtgcaaaatcttaaatctgaaatggaaaacctgagtctggcagcgatg
acggaccaattaacctcgctgcataatcgccgtgcctatgaactgagtattcaagatcaa
atctacctctcccaagatcatcaaacccgttgcagccttttactgatcgatatcgataac
tttaaagcctttaacgacacttatggccatttaaccggcgataaagtgttagcctatgtc
gcattagccttaaaacaatgtgtgcgaggggatgactttgtggcgcgctatggcggcgaa
gaatttgtggtggtgttgcctaacactcattttcacgatgcattacaagtggctgaaaat
cttcgggaacgtatctctgagcgccgcttaaccataggaaaagacaaaaaactttccctt
ggcgccattactgtttcgattggtctggcttcattgcagcaaggcgacgatgcagaaacc
ctattcagtcgcgccgacaaagcgctgtatcaagctaaggccgaaggccgtaactgcgtg
agaggataa

DBGET integrated database retrieval system