KEGG   Shewanella baltica OS223: Sbal223_2292Help
Entry
Sbal223_2292      CDS       T00803                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sbp  Shewanella baltica OS223
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sbal223_2292
Enzymes [BR:sbp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sbal223_2292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2726869..2729091
Genome map
AA seq 740 aa AA seqDB search
MMRSTQGLNAHSLSAAKWIDHGAIQLSAPLTELLKLWEQERLLTPLDRHFALEMSLLHPS
DSQQPLFMLLCALLSQQLSSQHSCLVLTHIVPLNPMAEQNSHCKITLSLEALIETLQTFD
AVGQAGSNKPLIFDNGRLYLQRYHQFETSVATALIRLSGSVSEHLTEDTSHQEQPQTAKL
RSLLDQLFPATVLAPQALTRNALTTNVLTKSEGTQSTAPIDWQKVATATALGKKLAVITG
GPGTGKTTTVTKLLLLLQMESQQEIRLVAPTGKAAARLSESIKASKARLAKELSAHADVV
DEARNRNNQDFLTALGRIPEEASTLHRLLGVIPNSPHFRHHQGNPLRLDLLIVDEASMVD
LPMMYKLLSALPEHASLILLGDQDQLASVEAGAVLADICAGLKIPVDPNNLAQNNIASNS
QALWQMRYSKEQAERLSALTGFELTPFINDSPKLGDSLCMLMHSHRFKGDAGIGQLASAV
NRADLQGILQVWQQGPAELNWLEHSMVVSQTQAKVSEPANNVGLNLLLDQACQQYGVYLR
ALNNHASNSDLGTRPSTADIIESFNQYRILCAMRSGDYGIEGINQYVTQALANAKLIKPL
QEFYLGRPIIIQSNDYNLGLFNGDIGLILQDEDKPERLMAHFIKADGSLLKVLPARLPSH
ETCYAMTVHKSQGSEFSRVALVLPPSPSLAQWQLLTKELVYTAITRAKVHFTCLGTQHVF
ERASSQATQRASGLADRLWG
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgctcaacccaagggctaaatgcacattcactctcagccgcgaaatggatagat
catggcgcaatccagcttagcgcgccgctaacagagctgttgaaactgtgggagcaggaa
cgactgctcacgccactcgatcggcatttcgcactcgagatgagtctcttacatccaagc
gacagccaacaacccttgtttatgttgctatgtgcgctgttgagccagcaattatcttca
cagcacagctgcctagtgctcacccatatcgtgccgcttaatcccatggccgagcaaaat
agccattgtaaaatcaccttaagcctagaagcgctcatagagactttgcaaacctttgat
gccgtcggccaagcaggaagcaacaaaccacttatttttgataatggcagactctatcta
caacgttatcatcaatttgaaacctcagtggccactgctttaatccgcctatcaggcagc
gtatctgagcacttaactgaagacacaagccaccaagagcaaccgcaaaccgctaagttg
aggtcgctgttagatcaactgttccctgccactgtgctcgcgccccaagctctcactcgc
aatgcactcactaccaatgtactcactaaaagtgaaggcacacaaagcactgcccccatt
gattggcaaaaggtcgccacggccactgcgctgggcaaaaaactggcggtgatcactggc
ggcccaggcacaggtaaaaccaccactgtgactaagcttttgttattattgcaaatggaa
tcacaacaggaaatccgtttagtcgcaccgacgggaaaagcggcggctcggttaagcgaa
tcgatcaaagcctcgaaagcgcgtctggcaaaggaactcagcgcccatgctgatgttgtt
gatgaagctcgcaatagaaataaccaagattttttaacggcattggggcgtattccagaa
gaggcatcaaccctacacagactgctcggggtgatccccaattccccgcactttcgccac
catcaaggtaatccgcttaggctcgacttattgatcgtcgatgaagcctctatggttgat
ttacccatgatgtataagttactgagcgcactgcccgaacacgccagtttgattttactt
ggcgatcaggatcaactcgcctcggttgaggctggcgctgtgctcgccgatatttgtgca
ggtcttaaaataccagtagatcccaataaccttgcacaaaataacatagcgtcaaacagc
caagctctgtggcaaatgcgctattccaaggagcaagccgagcgcctgagcgctttaacg
ggttttgagttaacgccctttatcaacgatagccctaaacttggcgatagcttgtgtatg
ctgatgcacagccatagatttaaaggcgatgcagggattgggcagcttgctagcgctgtc
aatcgcgcggatcttcaaggcatattgcaagtatggcaacaaggccctgctgaattgaac
tggctagaacacagtatggtcgtaagccaaacccaagccaaagtgagcgagcctgctaat
aatgtgggactcaatttactgctagatcaagcctgtcagcaatatggcgtttatctcaga
gccttgaataaccatgctagtaatagtgatctaggcacacgtccaagcacggctgacatc
atagaaagctttaaccagtaccgcattttatgcgccatgcgctcaggcgattatgggatt
gaaggcattaatcagtatgtgactcaagcactggccaatgccaagctgattaaaccgcta
caggagttttatctgggtcggcccattatcatccaaagcaatgactataacttaggcctg
tttaacggtgatatcggcctaattttgcaggatgaagataaacccgaacgtttaatggcg
cacttcatcaaggccgatggcagtctgttaaaagtcttgccagcccgtttgcccagccat
gaaacctgttacgccatgacagtacacaaaagccaaggcagtgagttcagccgtgtggcc
ttagtactgccaccgagccccagcctagcgcagtggcaactgctgaccaaagagttggtc
tacacagccatcacccgcgctaaagtgcattttacctgcttaggcacccagcacgtattc
gagcgggccagcagtcaagcaacccaacgcgcatcgggtcttgctgacaggctttggggt
taa

DBGET integrated database retrieval system