KEGG   Shewanella baltica OS223: Sbal223_2371Help
Entry
Sbal223_2371      CDS       T00803                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sbp  Shewanella baltica OS223
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sbal223_2371
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal223_2371
   00620 Pyruvate metabolism
    Sbal223_2371
   00650 Butanoate metabolism
    Sbal223_2371
  Lipid metabolism
   00071 Fatty acid degradation
    Sbal223_2371
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sbal223_2371
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sbal223_2371
   00626 Naphthalene degradation
    Sbal223_2371
Enzymes [BR:sbp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sbal223_2371
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Sbal223_2371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2829398..2832001
Genome map
AA seq 867 aa AA seqDB search
MTVTNAQELDLMVERVAKAQAEYATFSQAQVDNIFRAAALAAADARISLAKMAAVETRMG
VVEDKVIKNHFASEYIYNKYKDEKTCGILSEDVTFGTITIAEPVGIICGIVPTTNPTSTA
IFKALISLKTRNAIIFSPHPRAKVSTTTAAKLVLDAAIAAGAPKDIIGWIDEPSVALSNQ
LMTHPKVNLILATGGPGMVKAAYSSGKPAIGVGAGNTPIVIDETADIKRAVSSILMSKTF
DNGVVCASEQAVIVVDSIYEQVKERFISHGGYMLSKDETAAMQNVILKNGGLNADIVGQS
AASIAQMAGFEVPHWTKVLIGEVTDICDSEAFAHEKLSPLLGMYRAIDFNDAMDKAEALV
ALGGIGHTSGLYTDQDTQTERVHAFGFRMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPSHLINKKTVAKRAENMLWHKLPASIYFRRGSLPIALEELSDKKRA
LIITDRFLFNHGYCDETMRILKAQGLETEIFYDVEADPTLAIVRQGAKVAQSFKPDVIIA
LGGGSPMDAAKIIWVMYEHPDVDFADLALRFMDIRKRIYKFPKMGTKAMMVAIPTTSGTG
SEVTPFAVVTDEITGKKYPIADYQLTPNMAIVDPNLVMDMPKSLTAFGGIDAVTHALEAY
VSVMANEYSDGQALQALDLLCKYLPDAYNLGSQSPVAREKVHNGATIAGIAFANAFLGIC
HSMAHKLGAEFHLAHGLANALLINNVIRFNATDLPTKQAAFSQYDRPKALCRYAAIADHL
KLGGKTDEEKVEKLLEKITHLKTTIGIPASIQEAGVNEADFLAKLDELAEDAFDDQCTGA
NPRYPLINELKQLFLDSYYGRDYSDNN
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgaccaatgcacaagaactggatctcatggtcgagcgtgtagcgaaagcacaa
gccgagtatgcgacattcagccaagcgcaagtcgataacattttccgcgcagcggccctt
gccgctgccgatgcgcgtatctcgctggcgaaaatggccgccgtagagacccgcatgggt
gtcgttgaggacaaagtgatcaaaaaccactttgcctctgagtacatttataacaaatac
aaagatgaaaaaacctgcggaattttatctgaagacgtcaccttcggcactatcaccatt
gctgaacctgtgggtatcatttgtggcatagtaccgaccacgaaccctacatcgaccgcg
atatttaaggccttaatcagccttaaaacccgtaacgcaattatcttctcgccccatcct
agggccaaagtttccaccacaaccgcagcaaaattagtgctcgatgctgccatagctgcg
ggtgcacctaaagacattattggctggattgatgagccaagcgtcgcactgtcgaatcaa
ttgatgactcaccctaaggtcaacttgatcctcgcaacaggtggccctggcatggtgaaa
gccgcctactcttccggtaaacccgcgattggcgtaggtgcgggtaacacgcctattgtt
atcgatgaaaccgccgacatcaaacgcgcggtcagttcgattctcatgtcgaaaaccttc
gataacggcgtcgtttgtgcgtcagaacaagctgtgattgtggttgacagtatttatgag
caagtaaaagagcgctttatctcccacggtggctacatgctatcgaaggatgaaaccgcg
gcgatgcagaacgtcattttaaaaaatggcggtttgaatgccgatatcgttggccaaagc
gcggccagtatcgcgcaaatggccggctttgaagtgccgcattggacaaaagtattgatt
ggtgaagtcaccgatatttgtgacagcgaagccttcgcccatgaaaaattatcgccactg
cttggcatgtaccgcgccatagactttaacgatgccatggataaagccgaagccttagtc
gcacttggcggcattggtcacacttcagggctttataccgaccaagatacccaaactgaa
cgtgtgcatgcctttggttttagaatgaaaacagcacgtatcttgatcaacacccctgcc
tcacagggcgggattggcgatctgtacaacttcaaactagcaccttcactcactttgggc
tgtggttcttggggtggcaactcgatttcagaaaacgttggcccgagccatctgatcaac
aaaaaaaccgtcgctaagagggccgaaaacatgttgtggcacaagcttcctgcatccatc
tatttccgccgcggcagtttacccatcgcactcgaagaactgagcgataaaaaacgcgcg
ctgatcatcaccgacagatttttgtttaaccacggttattgcgacgaaaccatgcggatt
ttaaaggcccaaggccttgaaaccgaaatcttttacgatgttgaagccgatcccacttta
gccatagtccgtcaaggcgctaaggtggcccaaagctttaaacccgatgtgataattgcg
ctcggcggcggctcaccaatggatgcggcgaagattatttgggtgatgtacgagcatcca
gatgtggattttgccgatttggcgctgcgctttatggacattcgtaaacgtatctacaaa
ttccctaaaatgggcaccaaggccatgatggtggcaattccaaccacttcaggcacaggc
tcagaagtcacgccttttgcggtagtgacagacgaaattaccggtaaaaaatacccgatt
gccgattatcaactcacgcccaacatggcgattgttgacccaaatctagtgatggacatg
cctaaatctctgaccgcctttggtggcatagatgcggtgacccatgctcttgaagcctat
gtcagcgtgatggcaaacgaatatagcgacggccaagcactgcaagccctcgacttactg
tgcaaatatttacccgatgcgtacaacttgggctcacagtcacctgtcgcccgtgaaaaa
gtccacaatggcgccaccatcgcaggtatcgcctttgctaacgctttcctcgggatttgc
cactcaatggcgcacaaactgggcgcagagttccatctcgcccacggtttagccaatgcg
ctgctgatcaataacgtaatacgctttaacgcaacggatctgcccactaagcaagcggcc
tttagccaatacgacaggccaaaagccctgtgccgttatgctgccatcgcagatcacttg
aaactaggcggaaaaacggatgaagaaaaagtcgaaaaattgcttgagaaaatcacacac
ctcaagacgacgattggcattcctgcttctatccaagaagccggcgtcaacgaagccgac
ttcctcgccaagttagatgaattagctgaagatgcgttcgatgatcaatgtaccggtgcc
aatccacgttaccccttgattaacgagctgaaacaactgttcctcgatagctattatggc
cgtgactatagcgataacaactag

DBGET integrated database retrieval system