KEGG   Shewanella baltica OS223: Sbal223_2434Help
Entry
Sbal223_2434      CDS       T00803                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sbp  Shewanella baltica OS223
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sbp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2907372..2908355
Genome map
AA seq 327 aa AA seqDB search
MLNTPPLRRLRRLRSSEAMRDLLRETHISLSDLIHPLFIEEHITHAVPISTLPGISRLPE
SALADEVRELYALGIRYVMPFGISHTKDDKGSDAWDDNGLLARMVRTIKAAVPEMMVIPD
ICFCEYTDHGHCGVVHNNEVCNDLTVENLVKQSVTAAKAGADMLAPSAMMDGQVKAIRQG
LDATGFEHVAILAHSAKFASSFYGPFRAAVDCELSGNRKGYQLDYANGRQALLEASLDEA
EGADILMVKPGTPYLDVLSRLRQETHLPLAAYQVGGEYAGIKFAALAGALDERAVVTETF
VGLKRAGADLIVSYYTKQYAQWLAESR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacacgcctccattgcgtcgcctaagacgcttacgtagttcagaagcgatgcgc
gatctgctgcgcgaaacccatatttcgttaagcgatctcatccatcccctgttcattgaa
gagcacatcacccacgcagtgcctatctccacgctacctggtatcagccgtttaccagag
agtgcactggcggatgaagtgcgcgaactttacgccctcgggatccgttatgtaatgccc
tttgggatttcgcacactaaggatgataaaggcagcgacgcatgggatgacaatggcttg
ctcgcccgcatggtgcgcaccattaaagccgccgtgcctgagatgatggtgatccccgac
atttgtttttgtgaatacacagatcacggccattgcggcgtggtgcataataatgaagtc
tgcaacgatctcaccgtcgaaaatttagttaagcaatcagtcactgccgctaaagcgggc
gccgacatgctagcgccatcggccatgatggacggtcaagtgaaagccattcgccaaggg
cttgatgccacaggttttgagcatgtggcgattctggcccactcggcaaaattcgcctct
tccttctacggtcctttcagagcggcggtcgattgtgaactcagtggtaaccgcaaagga
tatcagcttgattatgccaacggtcgccaagccctgttagaagcctcattagatgaagcc
gaaggcgccgatatcctgatggttaaacccggtacgccctacttagatgtgttaagccgt
ttaagacaagaaacccacttaccactcgcagcctatcaagtcggcggcgaatatgcgggc
atcaagtttgcagcacttgcaggtgcgttggatgagcgtgcagtggtgactgaaacgttt
gtcggcttaaagcgggctggagcggatttgattgtcagctattacaccaaacagtacgcc
cagtggttagccgagagtagatag

DBGET integrated database retrieval system