KEGG   Shewanella baltica OS223: Sbal223_2446Help
Entry
Sbal223_2446      CDS       T00803                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
sbp  Shewanella baltica OS223
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2919727..2920752
Genome map
AA seq 341 aa AA seqDB search
MSLELLQAAALNLKKAVPLMLKHKIPTTPVNYALWYTYVGEQNPELNQRLDTVIAQYNTC
PPVSSELLYRQYVADPVELDVREMRQNLDAMVTELSQSLKDTNLDANEFQSRIESNFEKL
NRIEDEGFSVEQVLDLVRSLVKESDNIRSSTEFFTGQLQKAQTEIDALKKKLEQTEKDVL
YDALTGCFNRRAFDSDFAGMLAQAPLGTCLILADIDHFKVFNDTYGHQLGDQVLRAVAKR
LQESCRDGAKLYRFGGEEFVIIVPKSQLRIARQLAEAMRRGLEKLSLKDRRKDERINNIS
ASFGVAQWQEKQTGMQLIEAADKLLYDAKRLGRNRVLPISN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctagagttattacaagccgctgcactgaatctcaaaaaagcagtgcctctgatg
ctcaaacataaaattccgaccaccccggttaactatgcgctttggtacacttatgttggt
gaacagaatcccgaattaaatcaacgactcgataccgttatcgcccagtacaacacttgt
cctcctgtgagtagcgaactcttatatcgccagtatgttgccgatcccgttgaactcgat
gtccgcgaaatgcgccagaatctggatgctatggtgactgagctgtcccaatcgctcaaa
gataccaatctagatgccaatgaattccagtcgcgcatcgagagtaattttgaaaagctc
aaccgcatcgaagatgagggttttagtgttgagcaagtgctcgatctggtgcgcagttta
gtgaaagagtcggacaatattcgctcgagcactgagttctttaccggacaattgcagaaa
gcgcaaaccgaaatcgatgcgctaaagaaaaagctcgaacagacagaaaaagatgtgctt
tacgatgcgctgactggctgctttaatcgccgcgccttcgacagcgattttgccggtatg
ttggcccaagcgcccttaggcacctgcttgatcttggccgatatcgaccattttaaagtg
tttaacgacacctatggccaccagctcggcgaccaagtgttacgcgccgtggcgaaacgg
ctgcaggaatcctgccgcgatggcgcgaaactgtatcgttttggcggtgaagaatttgtg
attattgtgcctaaaagtcagttacgcatcgcaaggcaactggccgaagccatgcgccgt
gggctcgaaaagctcagtttgaaagacagacgtaaagacgagcgcatcaataatatcagt
gcctcatttggggttgcccaatggcaagaaaaacaaacgggcatgcaattgattgaagcg
gcagataaattactttatgacgctaaacgtttaggtcgaaatcgcgtgttaccgatcagc
aactaa

DBGET integrated database retrieval system