KEGG   Shewanella baltica OS223: Sbal223_2567Help
Entry
Sbal223_2567      CDS       T00803                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00010  Glycolysis / Gluconeogenesis
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01120  Microbial metabolism in diverse environments
sbp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal223_2567
Enzymes [BR:sbp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Sbal223_2567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACK47058
JGI: Sbal2232567
UniProt: B8EAM9
Position
3053799..3054647
Genome map
AA seq 282 aa AA seqDB search
MGSVTTKKHANGLDYVEVNTALCQARIFLQGAQIDYFQPVGKPPLLWVSSADDYQPGNGI
RGGVPVCWPWFGMSSEANFPQHGFARTRIWALESVEMRNQLVDLRFSLKISEQDKIYWPH
NTQVSVLFTLGDTLSITLVNTNLGDETVTLTQALHSYFPIEDICQLKASGFSGSKYIEFA
EGPYPQTTDEVRFDRETDRVYTDLGPVQLLHTPQGIIEVSRENSQSAVLWNPWIEKSQRL
GRFNPEDYLTMVCLEAANVLEDKVVLAPGETHNLVTHIRWKD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgtcactactaaaaagcacgccaacgggctcgattatgtcgaagtgaatacg
gcgttatgtcaggcaagaatttttttgcagggcgcgcaaatagactattttcaacccgta
ggaaaaccacctttgctgtgggtttcatcggctgacgattatcaacccggtaatgggatc
cgtggcggtgtgcccgtatgctggccttggtttggcatgagtagtgaagcgaacttcccc
caacacggattcgcccgtacccgcatttgggcgctggaatcggtagaaatgcgtaatcag
ttagtggatttacgttttagcttaaaaatcagtgagcaagataaaatctattggccgcat
aacactcaggtcagcgtgttattcaccctaggcgacaccctgagcatcactcttgtgaat
accaacttaggcgatgaaaccgtgacgctgacccaagcgctgcacagctatttcccgatt
gaggatatctgccaactcaaagccagcggttttagtggctcaaaatacatcgaatttgcc
gaggggccttatccacaaaccacggatgaagtgcgctttgatcgcgagacagatcgtgtc
tataccgatctcggcccagtgcaattattgcatacgccgcaggggataatcgaagtcagc
cgtgaaaacagccaatcagcggtattatggaatccatggattgaaaagtcacaacgcctt
ggtcggtttaatccagaagattatttgaccatggtctgtctagaagcggccaatgtttta
gaagataaagtcgtgcttgccccaggtgaaacccacaatttagtgacgcatattcgctgg
aaagactaa

DBGET integrated database retrieval system