KEGG   Shewanella baltica OS223: Sbal223_2656Help
Entry
Sbal223_2656      CDS       T00803                                 

Definition
RluA family pseudouridine synthase
Orthology
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
sbp  Shewanella baltica OS223
Brite
Enzymes [BR:sbp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.24  23S rRNA pseudouridine955/2504/2580 synthase
     Sbal223_2656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3120149..3121108)
Genome map
AA seq 319 aa AA seqDB search
MNIESTPQQVQLITIDEDHFEQRIDNYLMTKLKGVPKSMIYRIVRKGEVRVNKKRIKPEY
KLQIGDIVRIPPVRVAEPDNRTAPSPNLSKVSQLEDRILHEDNHLIVLNKPAGIAVHGGS
GVDYGVIEALRSLRPQQKFLELVHRLDKDTSGVLLVAKKRSALKHLHDQLRYKKMQKDYL
ALVKGEWSAQDKAVKQPLLKITLKSGERIVRVNAEGKPSETRFKIMQRYQGCTLVKASPV
TGRTHQIRVHCQFAGHPIACDDKYSEQGFDDSMRSLGLARLFLHAAELMFIHPENDEVMR
VSAPLDENLSQLLDKLKRV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagaatccaccccacaacaggttcagttgatcacgattgatgaagatcacttc
gaacagcgtatcgataactacttaatgaccaagctgaagggcgtgccgaaaagcatgatc
tatcgcattgtccgcaagggcgaggttcgagtaaataagaaacgcatcaaacccgagtac
aagttgcagattggcgacatagtgcgtattccgcctgtccgagtggcagagccagataac
cgtactgcaccatcgcctaacttaagtaaagtctcgcaactcgaagaccgtattttgcac
gaagacaatcatttgatcgtgctgaataaacctgctggcattgctgtgcatggtggtagt
ggtgttgattacggcgtgattgaagccctgcgttcactgcgtcctcaacaaaagttttta
gagctagtacatcgtctcgataaagatacttcgggtgtgttattggtggcgaaaaagcgt
agcgcgcttaaacatctgcatgatcagctcagatataaaaagatgcagaaagactatttg
gccttagttaaaggtgaatggtctgctcaagataaagccgttaaacagcctttattaaaa
atcaccctaaaatccggtgagcgcatagtgcgtgttaatgcggaaggtaagccttctgaa
acgcgctttaaaattatgcagcgttaccaaggttgtactctcgtgaaggcaagccctgtc
actgggcgaactcaccaaattcgggtgcattgccaatttgcgggtcatcctatcgcatgt
gatgataaatacagcgagcaaggttttgacgacagcatgcgttcattaggcttagctcga
ctctttttacatgcggctgagttgatgttcattcatcctgaaaatgatgaagtgatgcgg
gtctctgcgcccttagatgaaaacttgtcgcaattattagataagttaaagcgtgtgtaa

DBGET integrated database retrieval system