KEGG   Shewanella baltica OS223: Sbal223_2869Help
Entry
Sbal223_2869      CDS       T00803                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sbp  Shewanella baltica OS223
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sbal223_2869
   00052 Galactose metabolism
    Sbal223_2869
   00500 Starch and sucrose metabolism
    Sbal223_2869
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal223_2869
Enzymes [BR:sbp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sbal223_2869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3369316..3370224
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTIISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDEASCDLRRDNLAAMVALFDETQVGQIMVEGVPHNVVNQYGI
ADVNGHDLQPGESEPLVELVEKPAVDEAPSNLAVVGRYVLPASIWPLLAKTPAGAGDEIQ
LTDAIAMLMKQETVNAYYMEGKSHDCGNKQGYMRANVEYALRHSEIGEDFAQYLKTVVKG
MK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcccgtcgcaggcctaggcactcgtatg
cttcctgcgaccaaagcgattccaaaggaaatgctaccagttgtcgataagccattgatc
caatacgtggtcagtgaagctatcgctgctgggatcaaagaaattgttctagtgacccac
gccagtaaaaactctatcgaaaaccacttcgataccagtttcgaattagaagcccaactc
gagcgccgcgttaaacgtcagttactcgaagccgtgcaatcaatttgccctaaagacgtg
actatcatcagcgtacgtcaatctcaggcgaaaggattaggccacgccattttgtgcgca
aaatcagtcgtcggcgatgcaccatttgcagtattgctgccggatgtgatcatcgatgaa
gccagctgtgatctgcgtcgcgataacttagccgctatggttgcgctgtttgatgaaacc
caagtgggtcaaatcatggttgaaggcgtgccgcacaacgtcgtcaatcagtacggtatt
gctgatgtgaatggccatgatttacaacctggtgaatctgagccattagttgaattggtt
gagaaaccagccgtggatgaagcgccatctaacttagccgttgtaggccgttatgtatta
cctgccagcatttggccactactggctaaaacacctgcgggcgcgggcgatgaaattcaa
ttaaccgatgcgattgccatgttaatgaagcaagaaaccgtgaacgcttattatatggaa
ggcaagagtcacgactgtggtaacaagcaaggttacatgcgtgcgaacgttgaatacgcc
ctgcgccacagcgaaatcggtgaagattttgcgcaatatttaaaaaccgttgtaaaaggg
atgaagtaa

DBGET integrated database retrieval system