KEGG   Shewanella baltica OS223: Sbal223_2948Help
Entry
Sbal223_2948      CDS       T00803                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sbp  Shewanella baltica OS223
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:sbp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sbp00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sbp00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sbp00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sbp00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sbp00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3474908..3475750
Genome map
AA seq 280 aa AA seqDB search
MSVLCLDLGGTKLMLAQVEGKTLLDTWRYPVPADGNFEQLLDFLVTCIHSHLTPETYGIS
IGIPGMVDMHSGTLLEVLNIPALTATQLAQQLKNTFEMDVVVNNDANLFALGEAVLNRNQ
DMLGITLGTGVGAGVIFNGQLYSGKHCAAGEIGSLSYRDGIIEHYCSGQYFTTHHHMSGE
YLYQKACEGDSQALQAFAHFGEHLAHMIAQTLLIYDPKDIVLGGSVSQSFPFFIEALKQK
LQSLVYGPQLADLTISASQHHNAALIGAAQWFLQQKDLAK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcctatgtttagatcttgggggaactaaactgatgttggcacaggtggaaggt
aaaaccttactcgacacttggcggtatcccgttcccgccgatggcaatttcgaacagtta
ctcgatttcctcgtgacctgtatccacagccacctcacgcctgaaacctatggtatttcc
atcgggatacccggcatggtggatatgcacagcggcaccttactcgaagtgctcaacatc
cctgcgttgacggcaacgcagttagcccagcaacttaaaaatacctttgaaatggatgtt
gttgtgaataacgacgctaacctctttgcccttggcgaagctgtgctcaatcgcaatcaa
gacatgctcgggattaccttaggcacaggcgtgggcgctggggtgatttttaatggtcag
ttgtattcgggtaaacattgcgccgcaggagaaatcggcagtttgagttatcgcgatggc
ataattgagcactattgctcggggcaatacttcaccactcaccatcacatgagtggcgaa
tatttgtatcaaaaagcctgtgaaggagacagccaagcgctgcaagccttcgcccatttt
ggtgaacacttagcgcacatgatcgcccaaaccttactgatatacgatcccaaagatatc
gtccttggcggctcagtcagccaaagctttcccttttttattgaagcgcttaaacagaaa
ttgcaaagcttagtctatggcccccaactggcggacttgacgatttcagccagccaacat
cacaatgcggcactcattggcgccgcgcaatggtttttacaacaaaaggacttagctaag
tga

DBGET integrated database retrieval system