KEGG   Shewanella baltica OS223: Sbal223_2949Help
Entry
Sbal223_2949      CDS       T00803                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sbp  Shewanella baltica OS223
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal223_2949
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sbal223_2949
Enzymes [BR:sbp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sbal223_2949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3475747..3478488
Genome map
AA seq 913 aa AA seqDB search
MKGLIKQRGMIKWQGIKTALISGVMAVLPAMPVLSILAMPSVQAANAVQEANHVALNQLA
DKLQLNYQLTASYLETCPAKETQCYRSAIELTLPTQLSSDKLSSEELNHGDWQIYFSQLS
PVYFVDAGDFNIEHINGDLHKITPKASFKGFVADQVYRIEFYSQGSQITRSEFIPNFFVA
MGDKAQLIKSTQTQRNKETGLPEQDYLAPFNTEKQFLLAKNDATPFADGQYLAEEYQALA
ADKAPDISGKLIPTPLHSQSLDSAPLSLARGYRLTAATVDFKGRQAALDYLDSLGFSAKN
KGTPLLLQLDAQAPKVASTEAHDSEIKSNEAYRLTITAEQISIRAGNEAGLFYGLQSLAG
LISLSDDQLVAIEIQDQPRYAFRGLHIDLARNFHSLDFIKRIIPQLAAYKINKLHLHLAD
DEGWRLAIPGLPELTDVGAKRCFDLTEQTCLLPQLGSGIADANPVDGYLTVAQYQEILQL
ADAHHIEVIPSLDMPGHSRAAIKSMEARYHHYLAKGDKAKAEEFLLTEFADKTQYSSLQY
YHDNTLNVCLASTYHFIDTVIDEVKKMHQAVGIPLVHYHIGADETAGAWVDSPACIAMKK
QKADELAGLHSLNGYFIERVANMLADKGIIAAGWNDGMGEVRPENMPAQVQSNAWSLISD
NGHQIAHKQVNLGWKVVLSTPEVTYFDFPYVSHPDERGNHWAARAIDSFKVFSFMPDNLP
AHAERWRNSLNQPFIADDSHSQLKPGHGFYGLQGHLWSEMVQSDEQAEYMLFPRMIALAE
RAWHKASWELAYDYQGKIYSQQTQHFASQLNGQAEQVLKQDWQTFAAVYANKVQPKLAKA
GVFYRIAPPGILVENQLLVLNSLYPNAELEYQLDSGPWLSYLQAFKLNDVKHIRARVKDG
TRYSRPSTWQNTL
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggactaataaaacaaagagggatgattaagtggcaggggattaagacggcctta
atcagcggcgtcatggccgtgcttcccgcgatgccagtgctttcaatacttgcgatgcca
tcagtacaggcagccaacgccgtgcaggaggcaaatcatgtcgccctgaatcaattggcc
gataaactccaattaaattatcagttaaccgccagttaccttgaaacctgccccgcaaaa
gaaacccaatgctatcgctctgccattgagctaaccctgcccactcagctatctagcgac
aaattatccagtgaagagttaaatcacggcgactggcaaatctacttcagccaattatcg
cccgtttattttgtcgatgcgggtgactttaacattgagcatatcaatggcgatttacac
aaaatcactcctaaagccagctttaagggcttcgtcgccgatcaggtttatcgtattgag
ttttatagccaaggtagccaaatcacccgttccgagtttataccaaacttctttgtcgct
atgggtgataaagcgcagcttataaagagcactcaaacccagcgcaataaagaaacgggg
ttgcccgagcaagactacctcgcaccttttaataccgaaaaacaattcttactggcaaaa
aacgatgcaaccccctttgccgatggccagtatttagccgaggaatatcaagccttagcc
gcagacaaagcacctgacattagcggcaaacttatccccacgccacttcacagccaaagc
ttagactcggcgcctttatcccttgccagaggttatcgcctcacggctgcgactgtagat
tttaagggacgacaggcggcgttggattacctcgattctttaggcttttcggccaagaac
aaaggcacgccgctgttattacagctcgatgcccaagctcctaaagtcgccagcactgaa
gcccatgatagtgaaattaaaagtaacgaagcctatcggttaaccataacggctgagcaa
atcagtattcgagcgggcaatgaagcgggactcttctacggtctacaaagcctcgcaggg
ttgatcagtttaagtgacgatcaactggtcgccatcgagatccaagaccagcctcgctac
gcctttcgcggcctacacatcgatttagcccgtaacttccactcgctagattttattaaa
cgcatcattccacagctcgccgcctataaaatcaataagctgcatttgcacttagccgac
gatgaaggctggcgtttagccatacccggcttacctgaactaactgatgtgggcgcaaaa
cgctgtttcgatttaaccgagcaaacctgtttattgccacaactaggcagcggaattgct
gatgctaatcccgtcgatggctacttaaccgtggcgcaataccaagaaatattacaactg
gctgatgctcaccatatcgaagtgatcccttcattggacatgccagggcattcccgcgcc
gcgataaaatccatggaggcacgttatcaccattacctcgccaagggagacaaagctaag
gcggaggagtttttactgactgaatttgcagataaaacccaatattcgtcgcttcagtat
tatcacgacaacacactcaatgtgtgcttggcgagcacctatcactttatcgatacagtg
attgatgaagtcaaaaaaatgcaccaagccgtaggcattcccttagtgcattaccacata
ggcgccgatgaaaccgcgggcgcttgggtcgactctcccgcgtgtatcgcaatgaaaaaa
caaaaagccgatgagttagctggactccactcactcaatggctactttatcgaacgcgtt
gctaacatgctggcagataaagggattattgccgctggctggaatgatggcatgggtgaa
gtgcgccccgaaaacatgcccgcccaagtgcaatctaacgcttggtcactgatttcagac
aacggccatcaaatcgcccataagcaagtcaatcttggctggaaggtcgtgctctcaacg
ccggaagtcacctattttgattttccctatgttagccatccagatgagcgcggtaatcat
tgggctgcaagggcaatagacagctttaaggtgtttagctttatgcccgacaacctgccc
gcccatgccgagcgctggcgcaatagtttaaatcagccatttatcgcggacgacagccac
agccagctcaagccgggacacggtttttacggcttgcaggggcatctttggagcgaaatg
gtgcaatcggatgagcaagcagaatacatgctattcccgcgcatgatagcccttgcagaa
cgggcatggcacaaggcatcgtgggaattagcctatgattatcaaggtaaaatctatagc
caacagactcaacattttgccagccaactcaatggccaagccgagcaagtcctcaaacag
gattggcaaaccttcgccgcggtttacgccaataaagtgcagcctaagttagcaaaagcg
ggagttttctaccgcatagcaccacctgggattcttgttgaaaatcagctgttagtgctc
aatagcttatatcccaatgccgagctggaataccaactcgactcaggaccttggctaagc
tacctccaagctttcaagcttaatgatgtcaaacacatccgcgccagagtcaaagatggt
acgcgttactctcgcccatcgacttggcaaaacaccctctag

  All links  
No link information was found.   
DBGET integrated database retrieval system