KEGG   Shewanella baltica OS223: Sbal223_3028Help
Entry
Sbal223_3028      CDS       T00803                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sbp  Shewanella baltica OS223
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sbal223_3028
Enzymes [BR:sbp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sbal223_3028
Exosome [BR:sbp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal223_3028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3584081..3586312)
Genome map
AA seq 743 aa AA seqDB search
MMTQANAYFYDGADVALLNGQYTDVFSLLGMHSANEGKALIVRCFLRNALSVDVISIKDG
RKVASLDKVNEQGLFAGTLGRRVKPFLYLLRVEYPQCQLDIVDPYQFDSLLNSDDIYLFG
EGSAERAYEFLGANWRQTQGVEGVHFCVWAPNAKRVSVVGDFNHWDDTRHVMRQHLANGL
WELFLPNVVEGAHYKFDLVYQNGERHAKSDPMATQMECAPHNASIVPPKAHHSWNDTAWM
SKRAATAWHKAPMSAYEVHLGSWRRKGEQGEQYLDYQDLIEQLIPYVKEQGFTHIELMPI
SEFPFDGSWGYQPVGLYAPTHRFGDANGLKAFVDACHQAGIGIILDWVSAHFPKDPHGLV
RFDGTCLYEHEDPRKGTHPDWDTLIYNYDRGEVRSFLLSNACYWLREFHFDGLRLDAVSS
MLYLDYSREPGQWLPNTYGGRENLEAINFLQILNQRLYQAFPGICMIAEESTAFAGVTKP
TDQQGLGFGFKWNMGWMNDSLSYLGRDPLYRQFHHHQLTFSLMYAYTEQFMLSVSHDEVV
HGKGSLLHKIPGDDWQKFATLRAYYGFMWGHPGKKLLFMGCEFGQRNEWNHNQSLDWHLL
AYEPHQGVQRWLKDLNHLYQAMPALSVQDYEGAGFSWLDCENSRDSIFTFVRYGLAGDAP
LVFVINMTPQLHTGFRIGLPLAGDYREYLNSDSQIYGGSNQGNAGTVVAESLPWQGMAQS
ALITVPPLGCLVIGPATGLAEAN
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgatgactcaagccaatgcctatttttacgatggcgccgacgtcgccctacttaatggt
caatacactgatgttttttcgctcttgggtatgcacagtgccaatgagggtaaggcatta
attgttcgttgttttttacgcaatgccctcagtgtggatgtgatcagcattaaagatggc
cgcaaagtagcgagtctggacaaagttaacgagcagggattgttcgccggtacgctgggg
cgacgcgtcaaaccgtttctctatttgctgcgggtagaatacccccagtgtcagctagat
atagtcgacccttatcagtttgattcactgctcaatagtgacgatatttacctgtttggt
gaaggcagcgccgagcgcgcctatgagtttttaggcgccaactggcgtcagacccaaggc
gttgaaggtgtgcatttttgtgtgtgggcacccaatgccaaacgggtttctgtggtgggg
gatttcaaccattgggacgatactcgccatgtaatgcgccaacatcttgccaatggtttg
tgggagctatttctgcctaatgtggttgaaggcgcccactataagtttgatttggtttat
caaaatggtgagcgtcatgccaagtccgaccccatggcgactcaaatggaatgcgcgccc
cataatgcttctatcgtgcccccaaaagcccatcacagttggaatgataccgcttggatg
agtaaacgcgcggcgacagcttggcataaagcgcccatgtcggcctacgaagtgcactta
ggttcgtggcgtcgtaagggagagcaaggtgagcaatatcttgattatcaagacttgatt
gaacagcttattccctatgtgaaggagcaaggttttacccacattgaactgatgccgatc
agcgagtttcccttcgatggttcgtggggatatcagcctgtgggtctctatgcaccgacc
cacagatttggcgatgccaatgggttaaaagcctttgtggatgcctgccatcaggcggga
attggtatcatcctcgattgggtgtcggcgcattttcctaaggatccccacggcttagtg
cgtttcgatggcacttgtttgtatgagcacgaagatcctcgcaagggcacacatcccgat
tgggataccctgatttataactatgatcgcggtgaagtgcgcagtttcttgttgagtaat
gcctgttactggctgcgggagtttcattttgatggcctgcgtctcgatgccgtctcttct
atgttgtacctcgattacagccgcgagccgggccaatggctgcccaatacctatggtgga
cgggagaatctcgaagccattaatttcttacaaattttgaatcaacgcctgtaccaagcg
ttccccggcatttgcatgattgccgaagagtccaccgcctttgcgggggtgactaaaccg
acggatcagcaaggtctcggctttggctttaaatggaatatgggctggatgaacgacagc
ttaagctacttaggccgagatccgctttaccgccaattccaccatcatcaattgaccttc
agtttgatgtacgcctataccgagcaatttatgttgtccgtgagtcacgatgaagtggtc
cacggcaagggctcgttgctgcataaaattcccggtgatgattggcagaaatttgcgacc
ctgcgtgcttattacggttttatgtgggggcacccaggcaaaaaattactctttatgggc
tgcgagtttggtcagcgaaatgagtggaatcataaccagagtttagattggcacttattg
gcctatgaaccgcaccaaggtgtgcaacgttggcttaaagatctcaatcacttgtatcaa
gccatgcctgctttatcggttcaggattacgagggggcaggattcagttggctagattgt
gaaaatagccgcgacagcatctttacctttgtgcgttacgggttagcgggtgatgcgccg
ttagtgtttgtcatcaacatgacgccccaattgcacactgggttccgtattggtttgcct
ttggcgggggattaccgcgaatacctgaatagcgatagccagatttatggtggcagtaac
caaggtaatgcgggcactgtcgttgctgagtcgctgccgtggcagggcatggcgcagagc
gcgctgatcactgtgccgcccttgggttgcctagtgatagggcctgcaactggattggct
gaggcgaactag

DBGET integrated database retrieval system