KEGG   Shewanella baltica OS223: Sbal223_3029Help
Entry
Sbal223_3029      CDS       T00803                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sbp  Shewanella baltica OS223
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sbal223_3029
Enzymes [BR:sbp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Sbal223_3029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3586427..3588853)
Genome map
AA seq 808 aa AA seqDB search
MGLEKLLYLRGVGAEFTDCFGQEIHISEVDRQGILTCMLQEKNTVAGTAIDASATEALSS
DAGLTNVDAVLTEALIASQIDLLDARPWTQVLPEFHWCFVDEPWISLCLPETYTSDLSVA
IECEQGESIVFDVPFSALKSIGDYRIEQTLYLHYRLDLTQLGLARLDLAEAKTQASPEHS
MTAETEAVNLASYFLSSQEFTNNPALIKNQDSFAHAADKNASDFSVLGLGFHRIALSLKH
ALDTSAPAPSSALQSSVTAEADTSTLFSGTLMVAPRAAYQGVLTAVAQGKRHKPWGISVQ
LYSLRSETQWGIGDFGDLEQLIALVAAQGADFIQLNPLHALDIAAPEHPSPYSPCDRRRL
NPLYIQLQSVPEYQALTTEFSSATWIEAIALLNRDNWLDYPKVSELKYRAFEQLYRVFCE
THLANDTPRAQRFHEFVREQGTALQEFAQAEYLRSPKAFVQEEGFYLYLQFVAENQLHLC
QLKAKEVGMGLGLIRDLAVGAALQGSEVQANAEQFCLHASIGAPPDPFAPQGQNWGLTPL
DPVKLKQHNFSHFISLIRANMESCGALRIDHVMGLLRLWWWPLDKQLGHGAYVYYPVETM
LAIVCLESQRARCVVIGEDLGLVPPDIIHRLYTSGIYSNELFYFCKDHQGFKSPDQYKSQ
SLMMLANHDVPTLVAWWCGSDLHLRRQLSLFDSDEQLGDALAGREHEKQQLISLLAAQGL
LAEVTIAELDIQTLLTAWMTLGARGNSALYSVQLCDLLADRHAVNIPGTWLEYPNWQRRL
PLSLTQVSASPEILQRLQNIAAARQLPS
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggggctggaaaagttgctgtatttgcggggggttggagcagaatttactgattgtttt
ggccaagagatccatatttccgaggtagacaggcaaggtatcttgacctgtatgttacag
gaaaaaaacactgtggcagggactgccattgatgcttctgctacagaggcgttatcgagt
gatgctgggctgactaacgtcgatgcggtattgaccgaagcgctgatcgcctcacaaatt
gacttgctggatgcccgtccttggactcaggtgttacccgaattccattggtgttttgtg
gatgaaccttggataagcctttgtttacccgaaacctatacttcagatctgagtgtggcg
attgaatgcgaacagggtgagtctatcgtatttgatgtgccgttctcggcgcttaagtcg
attggcgattaccgcattgaacaaacgctttatctccactatcgccttgatcttacgcaa
ctgggattagcacgcctcgatttagcagaggccaagacccaagcttcccctgaacactca
atgaccgccgagactgaggcggtgaatttagcgtcctatttcctgagcagccaagagttc
actaacaacccagccttaatcaaaaaccaagactcatttgcgcatgcagccgacaaaaat
gcgagtgatttctctgtgttaggtttgggctttcatcgtatagctttaagcttaaaacat
gctctagataccagtgcaccagcgccaagctcagcgctacagagcagtgtgacggctgag
gctgataccagcactttgttttctggcaccttaatggtggcaccgcgggccgcttatcaa
ggcgtactcacggctgtcgcccaaggtaagcgccataaaccttgggggatcagcgttcaa
ctctacagtttacgcagcgagacccaatggggcattggtgactttggcgatttagaacaa
ctgatcgcgctggtggcggcgcagggcgcggatttcattcaactcaatcccttgcatgcc
ctcgacattgcggcgccagagcatccgagtccctatagtccgtgcgatcgccgcagactc
aatcctctttatattcaattacaaagcgttcctgaataccaagcacttaccactgaattt
tcaagcgctacttggatagaggccatcgccttactgaatcgtgacaattggctcgattat
cctaaggtgagtgagctcaaataccgtgcctttgagcagttatatcgcgttttttgtgaa
acccatttagcaaacgacacgcccagagcgcaaagattccatgagtttgtgcgtgagcag
ggcactgcgctgcaagagtttgctcaagcggaatacttacgtagcccaaaagcgtttgta
caagaggaaggtttctatctttacctgcaatttgtggccgaaaaccagttacacctttgc
cagctaaaagcgaaagaagtgggtatggggttgggattaatccgcgatttggccgttggc
gcagcgctgcagggcagtgaagtacaggccaatgccgagcagttttgtttgcatgccagt
atcggcgcaccgcccgatccctttgcgccccaagggcaaaattggggcttaacgcccctc
gatccggtgaagttaaaacaacataatttcagtcattttatctccttgatccgcgccaat
atggaaagctgtggcgccttgcgtatcgatcatgtgatgggcttactgcgcctctggtgg
tggccactggataaacaactcggccacggtgcctatgtgtattatcccgttgaaaccatg
ctcgctatcgtttgccttgagagtcaacgcgcccgctgtgtggtgattggtgaagactta
gggctagtgccaccggacattattcatcgtctctacacttctggcatttactccaacgaa
ttgttctatttctgcaaagaccatcaaggctttaaatcaccggatcaatacaagtcccag
agcctgatgatgctggcgaaccacgatgtaccgactttagtagcttggtggtgtggcagc
gatttgcacctgcgtcgacagttatccctatttgattctgacgaacaattgggcgatgcg
ctcgcagggcgggagcatgaaaagcagcagcttatttcactgttagccgctcaaggtctg
ttagccgaggtgacgatagccgaactcgatattcaaaccttgctcacggcttggatgacc
ctaggggctcgcggaaatagtgcgctgtacagcgtgcaactgtgtgatttattagccgat
cgccatgcggtgaacattcccggcacttggctcgaatatcctaactggcagcggcgctta
cctttgagtttaacgcaagtgtcggcttcgccagagatattgcagcgattacaaaatatc
gctgcggcgagacagctaccgagttaa

DBGET integrated database retrieval system