KEGG   Shewanella baltica OS223: Sbal223_3042Help
Entry
Sbal223_3042      CDS       T00803                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00630  Glyoxylate and dicarboxylate metabolism
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01120  Microbial metabolism in diverse environments
sbp01200  Carbon metabolism
Module
sbp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal223_3042
Enzymes [BR:sbp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Sbal223_3042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACK47527
JGI: Sbal2233042
UniProt: B8EAY5
Position
complement(3602750..3604075)
Genome map
AA seq 441 aa AA seqDB search
MTKATTQTSRQEQIDAIKRDWAENPRWKNVRRPYTAEEVVALRGSIVPENTIAKRGAAKL
WELVNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYP
ANSVPAVVSRINNSFRRADQIQWGNGVNPEDEKFVDYFLPIIADAEAGFGGVLNAFELMK
SMIDAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVDTLVIART
DANAADLLTSDCDPYDRDFVTGERTNEGFYRVKAGLDQAISRGLAYAPYADLIWCETAKP
DLEEARIFAEAIHAQYPDQLLAYNCSPSFNWKKNLDDATIARFQQALSDMGYKYQFITLA
GIHNMWYNMFDLAYDYARGEGMKHYVEKVQEVEFAAAKKGYTFVAHQQEVGTGYFDQVTT
VIQGGHSSVTALTGSTEEEQF
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggcaacgactcagacttcacgtcaagagcagattgatgcaatcaagagagat
tgggcagaaaacccacgttggaaaaacgtgcgtcgtccttacaccgcggaagaagtggtt
gcacttcgcggttcaatcgtgcctgagaatactatcgctaagcgtggtgcggctaagtta
tgggaactggttaacggcggcgctaaaaaaggctatgtgaattcgctcggtgcgttaacg
ggcggtcaagcggtacaacaggcgaaagcgggtatcgaagcgatttacctttctggttgg
caagtggctgcagatgctaacttagccggcactatgtacccagatcaatctttataccca
gcgaactcagtgccagctgtggtatcccgtatcaataactctttccgccgtgctgatcaa
attcaatggggcaatggcgttaatccagaagatgaaaaatttgttgattactttctgcca
atcattgctgacgcagaagcgggttttggcggcgtattaaatgccttcgaactgatgaag
tcgatgatcgacgcaggcgctgccggtgttcactttgaagatcagttagcttcagtgaag
aaatgtggtcacatgggcggcaaagtattagtgccaacccaagaagcggtacaaaagctg
gttgctgcacgtttagcggcggacgtgagcggtgtcgatacactggttatcgcccgtacc
gatgctaacgcggccgatttgttaacttcagattgcgacccatacgaccgtgatttcgtg
actggcgagcgcaccaatgaaggtttctaccgtgttaaagcgggtcttgaccaagcgatt
tctcgcggtcttgcctatgccccgtatgcggatttgatttggtgtgaaaccgctaaaccg
gatcttgaagaagcgcggatttttgctgaagcgattcatgctcagtacccagatcaactg
ttggcgtataactgttcgccttcgttcaactggaagaaaaatctggacgacgccactatc
gcgcgcttccaacaagcattgtcagacatgggttataagtaccagttcatcactttagcc
ggcattcacaacatgtggtacaacatgttcgacctcgcttacgactatgctcgtggcgaa
ggtatgaagcattatgttgagaaagttcaagaagttgagtttgctgcagcgaaaaaaggt
tacaccttcgtcgcgcatcaacaggaagtgggcacaggttatttcgaccaagtgactacg
gttattcaaggtggccattcatcagtgaccgcactgacaggttccaccgaagaagagcag
ttttaa

DBGET integrated database retrieval system