KEGG   Shewanella baltica OS223: Sbal223_3084Help
Entry
Sbal223_3084      CDS       T00803                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sbp  Shewanella baltica OS223
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sbal223_3084
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal223_3084
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sbal223_3084
Enzymes [BR:sbp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sbal223_3084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3658480..3659763)
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQKVSFKEAVQLGLGQDRGLFFPTQIPVLDDIEGLLALPFVERSKKVLGAW
LASELGQDAVDELVERAFNFDLPLVAVDEQRACLELFHGPTLAFKDFGARFMAQCVNAFV
GDTRLTILTATSGDTGAAVADAFYGLEKVNVVVLYPKGKISELQEKMFTTLGKNIHTVAV
SSDFDACQDLVKRAFDDPEVREGLSLNSANSINISRLLAQICYYFEAVAQSKQRHDADPV
ISVPSGNFGNLTAGLFAKAMGLPVKRFIAATNANDTVPRYLENGQWQPNQTQATMSNAMD
VSEPSNWPRVEAICEKLAWPLSNLVGMRLSEEQTSLALAELHAQGYVSEPHAAIAAKALS
LTLVPDEVGIFLGTAHPAKFKDVVDRELNLNLPLPVELEAVAHKPILSAELPADFAALKA
HLFKILA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaactatataatttaaaacacccttcgcagaaagtgagcttcaaagaagcagtgcaa
ttaggtttaggtcaggacagaggtttgttctttcccacccaaattccggtcttggacgat
attgaagggctgctggcgctgccatttgttgagcgcagtaaaaaagtgctcggtgcatgg
cttgcctctgaactagggcaagatgcagttgatgaactggttgagcgtgcctttaacttc
gatttacctttggttgccgtcgatgagcagcgcgcttgcctcgaattgttccacgggcct
actctggcatttaaagattttggtgcgcgttttatggcgcaatgcgtcaatgcctttgtc
ggcgacacacgcttaaccattctgactgcgacttcgggtgacactggcgccgcggttgcc
gatgccttttatgggcttgaaaaagtcaatgtagtggtgctctatcctaagggcaagatc
agtgagctacaggaaaagatgttcacgactttgggcaagaatatccatacagttgccgta
tcgtccgattttgatgcctgccaagatctggttaaacgcgcctttgatgatccagaagtc
cgcgagggtttgagcttaaactcggcgaactctatcaacatcagccgcttacttgcgcaa
atttgttattactttgaagccgttgcccagtctaaacaacgccacgacgccgatcctgtg
atttcagtgccaagtggtaactttggtaacctgacggcgggtttattcgccaaagccatg
gggttaccggttaaacgctttatcgccgcaaccaatgcgaatgatactgtgccgcgctat
ttagaaaacggccaatggcagcccaatcaaacccaagcgaccatgtctaatgcgatggat
gtgagtgagccaagtaactggccgcgagtggaagccatttgtgagaaattagcttggccg
ctgagtaacttagtgggcatgcgtttatctgaagagcaaacttcactggcattagctgag
ttgcatgcacagggttatgtgtctgagccccatgcggcgattgcagctaaagctttgtct
ttaaccttagtgcctgacgaagtgggtatattcttaggtacggcgcatcccgctaaattt
aaggatgtggtcgatagagagttaaatcttaacttaccactgccggttgaacttgaggcc
gttgcccataaacctattttatcggctgaattacccgccgattttgccgcactgaaagcg
cacttattcaaaatcttagcctaa

DBGET integrated database retrieval system