KEGG   Shewanella baltica OS223: Sbal223_3235Help
Entry
Sbal223_3235      CDS       T00803                                 

Definition
(GenBank) isoleucyl-tRNA synthetase
  KO
K01870  
isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
sbp  Shewanella baltica OS223
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Sbal223_3235
Enzymes [BR:sbp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     Sbal223_3235
Amino acid related enzymes [BR:sbp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Sbal223_3235
Transfer RNA biogenesis [BR:sbp03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Sbal223_3235
 Prokaryotic Type
   Other AARSs
    Sbal223_3235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3835892..3838714)
Genome map
AA seq 940 aa AA seqDB search
MSDYKFTLNLPETEFPMRGNLANREPEMLERWTKDGLYQQIRDSRIGRTPFILHDGPPYA
NGSIHIGHSVNKILKDIIIKSKTMSGFDAPYVPGWDCHGLPIELKVEQKVGKPGQKISAA
EFREECRKYAAEQVNGQREDFIRLGVLGDWQNPYLTMDFSTEANIVRSLSKVIESGHLHK
GVKPVHWCTDCGSALAEAEVEYEDKTSPAIDVAFVAADSKAVAAKFGVSDYSHPVSMVIW
TTTPWTLPANRALSLSPELDYSLVEFEKDGVTQALILAEVLVESCLTRYNVESHTVLGSA
KGAAFELVRFNHPFLDFDVPAILGDHVTTDAGTGIVHTAPGHGQDDFVVGQKYGLEVANP
VGDNGVYKPDTEYFAGQHVFKANDNVVALLREKSALLNHVAYRHSYPHCWRHKTPIIFRA
TPQWFISMDNHGLRTQALKEIEQTQWIPDWGQSRIEKMVENRPDWCISRQRTWGVPITLF
VNRETEELHPDSVSLMERVASRIEQQGIQAWWDLDAAELLGDEAEQYRKVTDTLDVWFDS
GSTFSSVVAARPEFHGHGVDLYLEGSDQHRGWFMSSLMISTAMNGKAPYKQVLTHGFTVD
GKGRKMSKSIGNVIAPQTVTNKLGADILRLWVAATDYSGEMTVSDEILNRSADAYRRIRN
TARFLLANLNGFEPAKDLVAVEDMVALDRWVVRRAAALQQEIIEAYEQYNFHIVTQKLMQ
FCSVELGSFYLDIIKDRQYTAKQEGHARRSCQSALYLISEAMVRWIAPILSFTADEVWQL
LPGERDAYVFTQEWYQGLKSVTLATDLSDDYWQQLLTVRNEVNKVIEQARRDKRIGGSLE
AEVTLFADAALTEQLTHIGDELRFVLLTSEAKVLPLADATSEAVETELASLKLLVASSTA
EKCERCWHHREEVGTIEAHPTLCTRCVTNIEGDGEVRLFA
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactataaatttactttgaatttgccggaaacagagtttccgatgcgtggtaat
ttggcaaatcgcgagccagagatgttagagcgctggacaaaagacggtttgtatcagcag
atccgtgatagccgaattggccgtactcccttcattttgcatgacggcccaccgtatgcg
aatggcagtattcatattggtcactcagttaataaaatcctcaaggacattattattaag
tcaaaaaccatgtctggttttgacgcaccgtatgtgccaggttgggattgccacggttta
cctatcgagctgaaagttgagcaaaaagtgggtaagccaggtcaaaaaatctctgcggca
gaattccgcgaagaatgccgtaaatacgccgccgagcaagttaatggtcaacgtgaagat
tttatccgtttaggcgtattaggcgactggcaaaatccatacctgacaatggatttttca
accgaagctaatattgtgcgttctttatcgaaagtgattgagagtggtcacttgcataaa
ggcgttaagccagtgcattggtgtactgattgcggttctgctttagctgaagctgaagtg
gaatacgaagacaaaacatcacctgctatcgatgtggcgtttgtggccgccgatagtaaa
gccgttgcggctaagtttggggtaagcgattactcacatcctgtttctatggtgatttgg
actaccacgccatggactctgcctgcgaaccgcgccttgtctttgagtcctgagctggat
tacagcttagttgaattcgaaaaagacggcgttacgcaagcgcttattttagctgaagta
ttagttgaatcttgcctgactcgctataacgtggaaagccatacagtgcttggctctgcc
aaaggcgcagcgtttgagcttgtccgctttaatcacccattcttagattttgatgttccg
gcaattttaggcgatcacgttacgacggatgcgggtactggtatcgttcacactgcccca
ggtcacggtcaagacgactttgtggttgggcaaaaatatggtttagaagtggcaaatcct
gttggcgacaacggtgtatacaagcctgatactgagtattttgctggacaacatgtcttt
aaagccaacgataacgtggttgcattactgagagaaaagagcgccttgctgaatcacgtg
gcttaccgtcatagctatccacattgctggcgccacaaaacaccgatcatcttccgtgcg
acgccgcagtggtttatctctatggataaccatggcctgcgtacgcaagcattgaaagaa
atcgaacagactcaatggatccctgattggggccaaagtcgtatcgaaaaaatggttgaa
aaccgccctgactggtgtatctcacgccaacgtacttggggtgtgcctatcacgctgttt
gtgaatcgtgaaactgaagagttgcacccagatagcgtctcgctaatggaacgtgtagcc
agtcgtattgaacagcaaggcattcaagcttggtgggatctcgatgccgccgaattattg
ggtgacgaagctgagcaataccgcaaagtaaccgacaccttagacgtttggtttgactca
ggttcaaccttctcgtcagtggtggcggctcgtcctgaattccacggacacggcgttgac
ttgtatcttgaaggtagcgaccaacatcgcggctggtttatgtcatctttgatgatttca
accgctatgaatggcaaagcaccttataagcaagtactaactcacggttttaccgtcgat
ggtaaaggccgcaagatgtcaaaatctatcggtaacgtgattgcgccgcaaacggtaacc
aacaaattaggcgccgatattctgcgtttatgggttgcggcaacagattacagcggtgag
atgacggtttctgacgaaatcttaaatcgtagtgccgatgcctatcgtcgtattcgtaac
actgcccgtttcctattagccaacttaaacggtttcgagcctgctaaggatttagttgct
gttgaagatatggtggcgttagaccgttgggttgtgcgccgcgctgctgcattgcaacag
gaaattattgaagcctatgagcaatataacttccatattgtgactcaaaaactgatgcag
ttctgctcggttgagttaggcagtttctatctggacatcatcaaagatcgccaatacacg
gctaagcaagaaggtcatgcgcgtcgcagctgtcaatcggcgctgtatttgatctctgag
gccatggtgcgttggattgcgccaattctaagcttcacagcggacgaagtgtggcaacta
ttgcctggcgagcgtgatgcctatgtctttactcaagaatggtatcaaggcttgaaatca
gtcaccttagcgacggatttgagcgacgactattggcagcaactgctgactgtgcgtaac
gaagtcaataaagtgattgaacaagctcgccgtgataaacgtattggtggttcattagaa
gcggaagtgaccttgtttgctgatgcagcgttgactgaacaattaacccatatcggcgat
gagctaagatttgtgttattgacctctgaagccaaagtcttgcctttagcggatgcgaca
tcggaagcggttgaaactgagctggcgtcactgaaattactggttgcttcaagcactgct
gagaagtgtgagcgttgttggcatcacagagaagaggttggcaccatcgaggcccaccca
acactctgtactcgctgcgtaacaaacattgaaggtgacggcgaagttcgtctgtttgcg
taa

DBGET integrated database retrieval system