KEGG   Shewanella baltica OS223: Sbal223_3243Help
Entry
Sbal223_3243      CDS       T00803                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
sbp  Shewanella baltica OS223
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sbal223_3243
Enzymes [BR:sbp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Sbal223_3243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3846579..3848945
Genome map
AA seq 788 aa AA seqDB search
MTQIHEINALKKYVRATNFLATSQIYLKQNVLHKRPLEHTDIKPRLLGHWGTCPGINFVY
ANINRLIVKHNRSFIYLVGPGHGFPAVQANLFMEGSLSHFYPETIPYNETGIEDICKKFS
AAYGYPSHANPEAPGQILEGGELGYSLSVGWGAVLDNPDLIATVLIGDGEAETGPLAASW
YANRLVSPATSGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYFPIIVDNELEED
IYVQMTNAMDTAYAMINDIQRRARSGEDVVKPKWPVILMRTAKGWTGVSEYKGKKLEGNC
ESHQVIVNKCATDKGHLDALDNWLASYYFQELYQMNDKGELIFDADICSLIPPKQLACGR
QHLTYGGEVVRALTNPDLEKLSYGPEVPRGHRGYSMLKMGEWMRDAFKLNRDQRNLRIFS
PDETYSNQLQAVFEETDRAWQWPIESWDEDMSREGRVIELLSENLLFGMLHGYTVTGRHG
MFPTYESFSQVISSMADQYCKYVYASQGVHFRKPLPSCNVVLSSLLERQDHNGYSHQNPS
FLGAMLEKHPKIISAYLPADANSTLVYTERAYADRDKLNILVAGKKELPQWLSLEEARKQ
AKDGVMVWDFASDENPDIVLAGCGDYVTQECMASLVLIRELLPRVKIRFVSVTELSSDGL
GSRKFKEKPWLMDEIFTQDKGVVFNYHGYPNTIKKLIFDYKGSRRFRIKGYEEEGSTTTP
FDMGVRNGTSRYHLVIDMAYKLFQQGVIDETMHVSITTDMLQRLVDHRNYIKANGIDPIE
IENWIWTR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaatacatgaaatcaatgctctgaaaaaatatgtcagagcgactaactttctt
gcgacctcgcagatttatctcaaacaaaacgtcttacataaacgtccacttgaacatact
gatatcaaaccacgtttacttggccactggggtacctgccctggcattaactttgtttat
gccaacattaaccgattgatagtgaaacataaccgctcgttcatctatttagttggtcca
ggccatggtttcccagcagtacaagctaacttattcatggaaggttcattaagtcatttc
tatccagaaacgatcccttacaatgaaaccggtatcgaagatatttgtaagaagttttcc
gccgcttatggctatccttcacatgcaaaccctgaagctccaggacaaattcttgaaggt
ggcgaactaggctactcactttctgttggctggggtgcagtactcgataatccagatctg
atcgccaccgtcttaattggtgacggtgaagcagaaaccggaccattagccgcgtcttgg
tacgcaaaccgtctagtctctcctgcgacaagtggtgcagtattaccgattgtgcatatc
aatggctataaaatttcaggccctacccgtatgggacgcatgagtcatgaagaactggat
cttgaattccgtggtcttggctacttccctattatcgttgataacgaattagaagaagat
atctatgtgcaaatgacgaatgccatggataccgcttatgccatgatcaatgatatccaa
cgtcgtgcccgtagcggcgaagatgtggttaagcctaaatggccagtgattttaatgcgc
accgccaaaggttggacgggtgtcagtgagtataaaggtaagaaattagaaggtaactgc
gaatcacaccaagtgatcgtcaataaatgtgccacagataaaggtcatctggatgcactt
gacaattggcttgccagttactacttccaagaactttaccaaatgaatgataaaggcgag
ctgatttttgatgccgacatttgctcattaattccacctaagcaacttgcctgtggtcgt
caacatctcacctatggtggtgaagtggttagagcgttaacgaaccctgatctcgaaaaa
ctcagctacggcccagaagtaccacgtggtcaccgtggttattcaatgttgaaaatgggt
gaatggatgcgtgatgcattcaagttaaaccgcgatcaacgcaatctacgtattttcagc
cctgacgaaacctattcaaatcaactacaagccgtatttgaagaaacagatcgtgcatgg
caatggccaattgagagctgggatgaagacatgtcccgcgaaggacgagtgattgagctc
ctttctgaaaacttgctctttggtatgttgcacggctacacagtaacaggccgccacggc
atgttccctacgtatgaatcattctcacaagtgatctcatcgatggccgaccaatactgt
aaatacgtctatgcaagccaaggtgtgcatttccgtaagccgctgccttcatgtaacgtc
gtattatcttcgctgcttgaacgccaagaccataatggctactcgcatcaaaacccgtct
ttccttggggcgatgctagagaagcatccaaaaattatctctgcttatttaccagcagat
gctaacagcaccttggtttatactgaaagggcttacgctgaccgcgacaaactcaatatt
cttgttgcaggtaagaaagagttaccacaatggctgagcttggaagaagcgcgtaaacaa
gcaaaagatggcgtgatggtgtgggattttgcctctgatgagaatccagatatcgtactg
gcaggttgtggtgattacgtcactcaagagtgtatggcttcattagtattgatcagagaa
ctccttccaagagtcaaaattcgcttcgttagcgtcaccgaattaagcagtgatggctta
ggaagccgcaaatttaaagaaaaaccttggttaatggacgaaatatttacccaagataaa
ggcgtggtattcaactaccatggttacccaaatacgattaaaaagttaatatttgattac
aaaggcagccgtcgcttcagaattaaaggctatgaagaagaaggttcaacaaccactcca
ttcgatatgggcgttcgtaacggcacatcacgttatcacctagtgattgatatggcttac
aaactgttccaacagggcgttattgatgaaactatgcacgtttcaatcaccacagacatg
ctacaaagactagttgatcaccgcaactacattaaagcgaatggcatcgacccaatagaa
attgagaattggatatggacacgttaa

DBGET integrated database retrieval system