KEGG   Shewanella baltica OS223: Sbal223_3433Help
Entry
Sbal223_3433      CDS       T00803                                 

Definition
flavocytochrome c
Orthology
K00244  
fumarate reductase flavoprotein subunit [EC:1.3.5.4]
Organism
sbp  Shewanella baltica OS223
Pathway
Oxidative phosphorylation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal223_3433
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal223_3433
  Energy metabolism
   00190 Oxidative phosphorylation
    Sbal223_3433
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sbal223_3433
Enzymes [BR:sbp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.4  fumarate reductase (quinol)
     Sbal223_3433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4078872..4080662
Genome map
AA seq 596 aa AA seqDB search
MFTRKIQKTALAMLISGAMAGTAYAAPEVLADFHGEMGSCDSCHVSDKGGVSDDNLSHEN
AQCVSCHGDLKELAAAAPKDKVSPHKSHLIGEIACTSCHKGHEKSVAYCDACHSFGFDMP
YGGKWERKFVPVDADKAAQDKAIAAGVKETTDVVIIGSGGAGLAAAVSARDAGAKVILLE
KEPVPGGNTKLAAGGMNAAETKAQAKLGIEDKKQIMIDDTMKGGRNINDPELVKVLANNS
SDSIDWLTSMGADMTDVGRMGGASVNRSHRPTGGAGVGAHVAQVLWDNAIKRGTDIRLNS
RVVRIIEDAKGNVTGVLVKGEYTGYYIIKADAVVIAAGGFAKNNDRVAKYDPKLKGFKAT
NHPGATGDGLDVAQQAGAATRDLEFIQAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFM
NEITTRDKASAAILQQKGESAYLVFDDSIRKSLKAIEGYVHLNIVKEGKTVEELAKQIDV
PAAELAKTITAYNGFVKSGKDAQFERPNLPRELAVAPFYALEIAPAVHHTMGGVVIDTKA
EVKSEKTGKPIQGLYAAGEVTGGVHGANRLGGNAVSDIVTYGRIAGAEAAKFAKDH
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgttcacaagaaagattcaaaaaacagcactagccatgctgatctctggcgcaatggca
ggaactgcctatgctgcaccagaagtgctagccgattttcacggtgaaatgggcagttgc
gacagctgccacgtctcagacaaaggtggcgtcagcgatgacaaccttagccatgaaaat
gcccaatgcgttagctgccacggcgatttaaaagaactggccgccgccgcacctaaagac
aaagtctcaccccataaatctcacttgattggcgaaattgcttgtacgagctgccataaa
ggtcatgaaaaatcagtcgcctattgcgatgcttgccacagcttcggcttcgacatgcct
tacggcggcaagtgggaacgtaagtttgttcctgttgatgctgacaaagcagcacaagat
aaagccattgctgctggcgtaaaagaaaccactgatgtggttattatcggttcaggtggt
gcgggccttgctgctgcagtatcagcccgtgatgctggcgcaaaagtaatcctgctcgaa
aaagaacctgtcccaggtggtaacactaaactggctgctggcggtatgaacgctgccgaa
acgaaggcgcaagctaagttaggtattgaagataagaaacaaatcatgatcgacgacacc
atgaaaggtggccgtaacattaacgatcctgaacttgttaaagtgcttgcgaataactct
tcagactctatcgattggttaacctctatgggtgccgatatgaccgacgtaggccgtatg
ggtggcgcaagtgttaaccgcagtcaccgcccaactggtggcgctggcgtaggtgcacac
gttgcgcaagtgctgtgggacaatgcaatcaaacgtggtacagacatccgcttaaacagc
cgtgttgtccgtattattgaagatgcgaaaggcaatgtgactggcgtactcgtaaaaggc
gaatacactggctactacataatcaaagccgatgccgttgttattgctgccggtggtttt
gcgaaaaacaacgaccgcgtagctaaatacgatcctaagttaaaaggctttaaagccact
aaccacccaggtgcaaccggtgatggcttagacgtagcacaacaagctggcgcagcaact
cgcgatttagagttcattcaagctcacccaacttactcaccagcaggtggcgtgatgatc
accgaagcggtacgtggtaacggtgctatcgtggttaaccgtgaaggtaaccgctttatg
aacgaaatcactacccgtgataaagcgtctgccgcgattctgcaacaaaaaggcgaaagt
gcttatctagtgttcgatgactcaatccgtaagagcttaaaagcgattgaaggttatgtg
catctgaacattgttaaagaaggcaaaaccgtcgaagagttagcaaaacaaattgatgtg
cccgccgctgaactggctaaaaccatcacggcatacaacggtttcgtgaaatcaggtaaa
gatgcgcaatttgaacgtccaaacctaccacgcgaattagcagtagcacctttctacgca
ttagaaatcgcacctgctgttcaccacactatgggtggcgttgtgattgatactaaagcc
gaagtgaagagcgaaaaaaccggtaaaccaatccaaggcttatatgccgcaggtgaagtg
actggcggtgttcacggtgctaaccgtctaggcggtaacgcagtatctgacattgtgacc
tacggccgtatcgccggtgcagaagcggctaaattcgctaaagatcactag

  All links  
No link information was found.   
DBGET integrated database retrieval system