KEGG   Shewanella baltica OS223: Sbal223_3433Help
Entry
Sbal223_3433      CDS       T00803                                 

Definition
flavocytochrome c
Orthology
K00244  
fumarate reductase flavoprotein subunit [EC:1.3.5.4]
Organism
sbp  Shewanella baltica OS223
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Two-component system
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal223_3433
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal223_3433
   00620 Pyruvate metabolism
    Sbal223_3433
   00650 Butanoate metabolism
    Sbal223_3433
  Energy metabolism
   00190 Oxidative phosphorylation
    Sbal223_3433
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sbal223_3433
Enzymes [BR:sbp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.4  fumarate reductase (quinol)
     Sbal223_3433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4078872..4080662
Genome map
AA seq 596 aa AA seqDB search
MFTRKIQKTALAMLISGAMAGTAYAAPEVLADFHGEMGSCDSCHVSDKGGVSDDNLSHEN
AQCVSCHGDLKELAAAAPKDKVSPHKSHLIGEIACTSCHKGHEKSVAYCDACHSFGFDMP
YGGKWERKFVPVDADKAAQDKAIAAGVKETTDVVIIGSGGAGLAAAVSARDAGAKVILLE
KEPVPGGNTKLAAGGMNAAETKAQAKLGIEDKKQIMIDDTMKGGRNINDPELVKVLANNS
SDSIDWLTSMGADMTDVGRMGGASVNRSHRPTGGAGVGAHVAQVLWDNAIKRGTDIRLNS
RVVRIIEDAKGNVTGVLVKGEYTGYYIIKADAVVIAAGGFAKNNDRVAKYDPKLKGFKAT
NHPGATGDGLDVAQQAGAATRDLEFIQAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFM
NEITTRDKASAAILQQKGESAYLVFDDSIRKSLKAIEGYVHLNIVKEGKTVEELAKQIDV
PAAELAKTITAYNGFVKSGKDAQFERPNLPRELAVAPFYALEIAPAVHHTMGGVVIDTKA
EVKSEKTGKPIQGLYAAGEVTGGVHGANRLGGNAVSDIVTYGRIAGAEAAKFAKDH
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgttcacaagaaagattcaaaaaacagcactagccatgctgatctctggcgcaatggca
ggaactgcctatgctgcaccagaagtgctagccgattttcacggtgaaatgggcagttgc
gacagctgccacgtctcagacaaaggtggcgtcagcgatgacaaccttagccatgaaaat
gcccaatgcgttagctgccacggcgatttaaaagaactggccgccgccgcacctaaagac
aaagtctcaccccataaatctcacttgattggcgaaattgcttgtacgagctgccataaa
ggtcatgaaaaatcagtcgcctattgcgatgcttgccacagcttcggcttcgacatgcct
tacggcggcaagtgggaacgtaagtttgttcctgttgatgctgacaaagcagcacaagat
aaagccattgctgctggcgtaaaagaaaccactgatgtggttattatcggttcaggtggt
gcgggccttgctgctgcagtatcagcccgtgatgctggcgcaaaagtaatcctgctcgaa
aaagaacctgtcccaggtggtaacactaaactggctgctggcggtatgaacgctgccgaa
acgaaggcgcaagctaagttaggtattgaagataagaaacaaatcatgatcgacgacacc
atgaaaggtggccgtaacattaacgatcctgaacttgttaaagtgcttgcgaataactct
tcagactctatcgattggttaacctctatgggtgccgatatgaccgacgtaggccgtatg
ggtggcgcaagtgttaaccgcagtcaccgcccaactggtggcgctggcgtaggtgcacac
gttgcgcaagtgctgtgggacaatgcaatcaaacgtggtacagacatccgcttaaacagc
cgtgttgtccgtattattgaagatgcgaaaggcaatgtgactggcgtactcgtaaaaggc
gaatacactggctactacataatcaaagccgatgccgttgttattgctgccggtggtttt
gcgaaaaacaacgaccgcgtagctaaatacgatcctaagttaaaaggctttaaagccact
aaccacccaggtgcaaccggtgatggcttagacgtagcacaacaagctggcgcagcaact
cgcgatttagagttcattcaagctcacccaacttactcaccagcaggtggcgtgatgatc
accgaagcggtacgtggtaacggtgctatcgtggttaaccgtgaaggtaaccgctttatg
aacgaaatcactacccgtgataaagcgtctgccgcgattctgcaacaaaaaggcgaaagt
gcttatctagtgttcgatgactcaatccgtaagagcttaaaagcgattgaaggttatgtg
catctgaacattgttaaagaaggcaaaaccgtcgaagagttagcaaaacaaattgatgtg
cccgccgctgaactggctaaaaccatcacggcatacaacggtttcgtgaaatcaggtaaa
gatgcgcaatttgaacgtccaaacctaccacgcgaattagcagtagcacctttctacgca
ttagaaatcgcacctgctgttcaccacactatgggtggcgttgtgattgatactaaagcc
gaagtgaagagcgaaaaaaccggtaaaccaatccaaggcttatatgccgcaggtgaagtg
actggcggtgttcacggtgctaaccgtctaggcggtaacgcagtatctgacattgtgacc
tacggccgtatcgccggtgcagaagcggctaaattcgctaaagatcactag

DBGET integrated database retrieval system