KEGG   Shewanella baltica OS223: Sbal223_3433Help
Entry
Sbal223_3433      CDS       T00803                                 

Definition
flavocytochrome c
Orthology
K00244  
fumarate reductase flavoprotein subunit [EC:1.3.99.1]
Organism
sbp  Shewanella baltica OS223
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Two-component system
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:sbp01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sbp00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sbp00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:sbp00190]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sbp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4078872..4080662
Genome map
AA seq 596 aa AA seqDB search
MFTRKIQKTALAMLISGAMAGTAYAAPEVLADFHGEMGSCDSCHVSDKGGVSDDNLSHEN
AQCVSCHGDLKELAAAAPKDKVSPHKSHLIGEIACTSCHKGHEKSVAYCDACHSFGFDMP
YGGKWERKFVPVDADKAAQDKAIAAGVKETTDVVIIGSGGAGLAAAVSARDAGAKVILLE
KEPVPGGNTKLAAGGMNAAETKAQAKLGIEDKKQIMIDDTMKGGRNINDPELVKVLANNS
SDSIDWLTSMGADMTDVGRMGGASVNRSHRPTGGAGVGAHVAQVLWDNAIKRGTDIRLNS
RVVRIIEDAKGNVTGVLVKGEYTGYYIIKADAVVIAAGGFAKNNDRVAKYDPKLKGFKAT
NHPGATGDGLDVAQQAGAATRDLEFIQAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFM
NEITTRDKASAAILQQKGESAYLVFDDSIRKSLKAIEGYVHLNIVKEGKTVEELAKQIDV
PAAELAKTITAYNGFVKSGKDAQFERPNLPRELAVAPFYALEIAPAVHHTMGGVVIDTKA
EVKSEKTGKPIQGLYAAGEVTGGVHGANRLGGNAVSDIVTYGRIAGAEAAKFAKDH
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgttcacaagaaagattcaaaaaacagcactagccatgctgatctctggcgcaatggca
ggaactgcctatgctgcaccagaagtgctagccgattttcacggtgaaatgggcagttgc
gacagctgccacgtctcagacaaaggtggcgtcagcgatgacaaccttagccatgaaaat
gcccaatgcgttagctgccacggcgatttaaaagaactggccgccgccgcacctaaagac
aaagtctcaccccataaatctcacttgattggcgaaattgcttgtacgagctgccataaa
ggtcatgaaaaatcagtcgcctattgcgatgcttgccacagcttcggcttcgacatgcct
tacggcggcaagtgggaacgtaagtttgttcctgttgatgctgacaaagcagcacaagat
aaagccattgctgctggcgtaaaagaaaccactgatgtggttattatcggttcaggtggt
gcgggccttgctgctgcagtatcagcccgtgatgctggcgcaaaagtaatcctgctcgaa
aaagaacctgtcccaggtggtaacactaaactggctgctggcggtatgaacgctgccgaa
acgaaggcgcaagctaagttaggtattgaagataagaaacaaatcatgatcgacgacacc
atgaaaggtggccgtaacattaacgatcctgaacttgttaaagtgcttgcgaataactct
tcagactctatcgattggttaacctctatgggtgccgatatgaccgacgtaggccgtatg
ggtggcgcaagtgttaaccgcagtcaccgcccaactggtggcgctggcgtaggtgcacac
gttgcgcaagtgctgtgggacaatgcaatcaaacgtggtacagacatccgcttaaacagc
cgtgttgtccgtattattgaagatgcgaaaggcaatgtgactggcgtactcgtaaaaggc
gaatacactggctactacataatcaaagccgatgccgttgttattgctgccggtggtttt
gcgaaaaacaacgaccgcgtagctaaatacgatcctaagttaaaaggctttaaagccact
aaccacccaggtgcaaccggtgatggcttagacgtagcacaacaagctggcgcagcaact
cgcgatttagagttcattcaagctcacccaacttactcaccagcaggtggcgtgatgatc
accgaagcggtacgtggtaacggtgctatcgtggttaaccgtgaaggtaaccgctttatg
aacgaaatcactacccgtgataaagcgtctgccgcgattctgcaacaaaaaggcgaaagt
gcttatctagtgttcgatgactcaatccgtaagagcttaaaagcgattgaaggttatgtg
catctgaacattgttaaagaaggcaaaaccgtcgaagagttagcaaaacaaattgatgtg
cccgccgctgaactggctaaaaccatcacggcatacaacggtttcgtgaaatcaggtaaa
gatgcgcaatttgaacgtccaaacctaccacgcgaattagcagtagcacctttctacgca
ttagaaatcgcacctgctgttcaccacactatgggtggcgttgtgattgatactaaagcc
gaagtgaagagcgaaaaaaccggtaaaccaatccaaggcttatatgccgcaggtgaagtg
actggcggtgttcacggtgctaaccgtctaggcggtaacgcagtatctgacattgtgacc
tacggccgtatcgccggtgcagaagcggctaaattcgctaaagatcactag

DBGET integrated database retrieval system