KEGG   Shewanella baltica OS223: Sbal223_3448Help
Entry
Sbal223_3448      CDS       T00803                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sbp  Shewanella baltica OS223
Brite
Enzymes [BR:sbp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Sbal223_3448
Secretion system [BR:sbp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sbal223_3448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4097122..4097847)
Genome map
AA seq 241 aa AA seqDB search
MKLTRALSLIFALVVAPLAHAATATSPDTAAIKQKLTEMLDVEVISMQDSPIEGLYQAMT
NRGVLYISRDGSKLFHGSLYDLDKGMKNLTEAALAGPRLEMMKPLEDHMLVYKAKNEKHV
VTVFTDVSCGYCRKLHSQMADYNKLGITVRYLAFPRAGVPSANADEMQAIWCAKDPLKAM
TDAKAGSKVAAATCDAKIAEQYALGTTFGVNGTPAIVLEDGNMIPGYQPPADLLRTLEAR
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaacccgagcattatctttaatttttgcccttgttgtagctcctcttgctcac
gccgcaacagcgacctcgccagataccgctgctattaagcaaaaactgactgagatgttg
gatgttgaagtcatttctatgcaggattcgccgattgagggtttgtatcaagctatgacc
aaccgcggcgtgctctatattagtcgtgatggttcaaaactgttccacggcagtttgtat
gacctagataaaggcatgaaaaacttaacggaagcggcattagctggcccacgtttagaa
atgatgaagccgcttgaagaccatatgttggtttacaaagccaaaaatgaaaaacacgtg
gtcactgtatttaccgacgtcagctgtggttattgccgtaaattgcacagccaaatggcc
gattacaacaagcttggcattaccgtacgttacttagccttcccgcgtgcgggcgtgccg
tcagccaacgccgacgaaatgcaagccatctggtgtgctaaagatccattaaaagccatg
acagacgctaaagcgggcagcaaagtggcagcagcaacatgcgatgctaaaattgccgag
caatatgctttaggcaccacctttggtgtgaatggtacgccggcaatcgtgttagaagat
ggcaatatgatcccaggttatcaaccccctgcggacttattacgcaccttagaagcgcgt
cagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system