KEGG   Shewanella baltica OS223: Sbal223_3549Help
Entry
Sbal223_3549      CDS       T00803                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sbp  Shewanella baltica OS223
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sbp00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4211861..4212715
Genome map
AA seq 284 aa AA seqDB search
MPAAISRNWPAPAKLNLFLHINGRRADGYHELQTLFQFIDCCDMLDFKVTETPELILHSN
MSGVVADSDNLILRAAKSLQQTTGFNGGAEIWLDKRLPMGGGLGGGSSDAATTLVALNKL
WHTQLSTEELAKIGLKLGADIPVFIHGFAAFAEGVGERLQAVNPSEPWYLVIAPDAHVST
ADVFQDPLLPRDTPKLAIDTLMSQPWANDCQKLVVSKYPQVAKALGWLLEYAPSRMTGTG
ACVFGEFTQQQQALAALAKLPSEMQGFVAQGMNLSPLITRLSHP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgcaatttcccgcaattggcctgcgccagccaagctcaacttgtttttgcac
ataaatggtcgccgcgccgacggttaccacgaactgcaaaccttgtttcagtttatcgat
tgctgcgacatgctcgattttaaggtcactgaaacccctgaactgattttgcactccaat
atgtcgggcgttgtcgctgacagcgataacttaattctgcgagccgcaaaatcattacag
caaaccacaggctttaacggtggcgctgagatctggctggataaacggctgcccatgggc
ggcggtttaggcggcggctcgtccgatgctgcgaccacattagtggcattgaacaagtta
tggcatacccaattatcgaccgaagaattggctaaaatcggccttaaattgggtgccgat
attcctgtttttattcatggtttcgccgcttttgccgaaggtgtgggtgaacgcttacaa
gcagtaaatccgagtgagccttggtacttagtcatagcacccgatgcccatgtttccacc
gcagacgtattccaagatccacttttaccgcgtgataccccgaaactggccatagatacc
ttaatgagccaaccttgggcaaatgattgccaaaaactagtcgtttctaaataccctcaa
gttgccaaggcattaggctggctgctagaatatgcgccgtcgagaatgacaggaacaggc
gcatgcgtgttcggggaattcacacaacagcaacaagctctcgcagccttggcgaaatta
ccgtctgaaatgcaaggatttgttgcacaagggatgaatctttcgccgctcatcacgcga
ctcagtcacccttaa

DBGET integrated database retrieval system