KEGG   Shewanella baltica OS223: Sbal223_3580Help
Entry
Sbal223_3580      CDS       T00803                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sbp  Shewanella baltica OS223
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sbal223_3580
Enzymes [BR:sbp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sbal223_3580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4250355..4251266
Genome map
AA seq 303 aa AA seqDB search
MSQILVIGSANADHVMKFEYLPAAGQTLMSRDYRLELGGKGANQAVACARLAKPGSRTDF
ICHLGQDSIGDDMRQSWIKDGISTEGISQVAEQSTGTAMIFIGDNGENTIGVAAGANATL
SPDDLENHYALFSRAQFLLTQLETPAATVAKALQMAKNLGVTTVLNPAPATALGQDCLKW
VDIITPNETEAEALTGVEINHLDDAQMAAQLLHQQGVGIVVITLGSRGAYISSPGFTGLV
PALEVQAIDTVAAGDTFNGALVVGLSEGMSIAAAVGFANAASAITVTRQGAQRAIPYRQE
LSY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagccagatactcgttatcggcagtgcaaatgccgaccatgtgatgaaatttgagtac
ctgcccgctgcagggcaaaccttaatgagccgagattatcgcctcgaactgggcggcaaa
ggtgccaaccaagctgtcgcctgcgcgcgcttagccaaaccaggctcccgcactgacttt
atctgccacctcggccaagacagtatcggcgatgatatgcgtcaaagctggattaaagat
ggcataagtacagaaggaattagccaagtagcggagcagagtaccggtaccgcgatgatt
tttatcggtgacaacggtgaaaataccattggtgttgctgcgggtgccaacgccactctt
tcacccgatgatttagaaaatcactatgctcttttttcccgtgctcaattccttttgact
caactagaaacgcctgcagccacagtggcaaaagcattacaaatggccaaaaatcttggt
gtgacgacggtattaaatcccgctccagcgaccgcccttgggcaagattgtctcaagtgg
gtagatataattacgcctaatgagacagaagcagaggccttaacaggggttgaaattaat
catctcgatgatgcccaaatggctgcgcagctcctccaccagcaaggtgtagggattgtg
gtgatcactttaggcagtcgaggcgcatatatcagcagcccaggttttactgggctagta
cccgcgcttgaagtgcaagccatagacacagtcgccgcaggagataccttcaacggcgcc
ttagtcgttggcttgagcgaaggcatgtcgattgccgccgccgttggatttgctaatgcg
gccagtgccattactgtgactcgccaaggcgcacagcgtgctatcccatatcgacaggag
ctttcgtactaa

DBGET integrated database retrieval system