KEGG   Shewanella baltica OS223: Sbal223_3625Help
Entry
Sbal223_3625      CDS       T00803                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00670  One carbon pool by folate
sbp00790  Folate biosynthesis
sbp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal223_3625
   00670 One carbon pool by folate
    Sbal223_3625
Enzymes [BR:sbp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Sbal223_3625
    1.5.1.50  dihydromonapterin reductase
     Sbal223_3625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: ACK48104
JGI: Sbal2233625
UniProt: B8EB53
Position
complement(4304287..4305033)
Genome map
AA seq 248 aa AA seqDB search
MTSPIIITGVGKRIGYALAKHFLAQGQQVIGTYRSHYDSIDELNALGATLYPCDFYDDAQ
VSFLIAVLAKLPQIRAIIHNASDWLPDPVLTKNEPLKSTTFAPSQVLQRMMQVHVSVPYQ
LNLALEAQLRAAAGDEIGGSDVIHITDYVAEKGSQKHIAYAASKAALHNMTLSFAAKFAP
EVKVNSIAPAMILFNAGDDAVYQQKTLAKALLPKEAGNEEIIELVDYLLNSRYVTGRCHN
VDGGRQLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcccatcataatcacaggcgtgggtaaacgcataggttacgccttagccaaa
cattttctcgctcaaggtcagcaggtgattggtacttatcgcagccattacgatagcatt
gatgagctgaacgctttaggcgcgactctgtatccctgcgatttttatgacgatgcccaa
gtgagcttcttaattgctgtgttagctaaattgccgcaaattcgcgccattattcacaat
gcttcggactggctgccggatcctgttcttacaaagaatgagcctttaaagagtaccact
tttgcgccgagccaagtgctgcagcggatgatgcaagtgcatgtgagcgtgccctatcag
ttgaacttggccttagaggcgcagctacgcgccgctgctggcgatgaaatcggcggcagt
gatgtgattcatattaccgattacgtggcagagaagggcagtcagaagcacatagcctat
gccgccagtaaagccgcgctgcacaatatgacgctatcctttgccgccaaattcgcgccc
gaggtgaaagtcaattcgattgcaccagcgatgatcctatttaatgcgggagatgacgcc
gtctatcagcaaaaaaccttagccaaagcgctgttgccgaaagaggcggggaatgaggag
attattgaactcgtggactacctgcttaatagccgttacgtcaccggtcgttgccataat
gtcgacggcggtcgccagttaaaatag

DBGET integrated database retrieval system