KEGG   Shewanella baltica OS223: Sbal223_3855Help
Entry
Sbal223_3855      CDS       T00803                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sbp  Shewanella baltica OS223
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal223_3855
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal223_3855
   00020 Citrate cycle (TCA cycle)
    Sbal223_3855
   00620 Pyruvate metabolism
    Sbal223_3855
Enzymes [BR:sbp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sbal223_3855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4577767..4579764)
Genome map
AA seq 665 aa AA seqDB search
MAELKEVFVPDIGGDEVQVIEICVAVGDTLAAEESILTVESDKATMDIPAPFAGVLAELK
VAVGDKVSEGTLIAMMQAAGAAAAAPAPVAAPAQAAPASAPVQAAPAAPAASAQAVETKV
VEVTVPDIGGDTDVSIIEVLVAVGDKIEVDSGLITLETDKATMDVPSPFAGVVKDVKVAV
GDKVSQGSLVIMLEVGGAAPVAAPAATVAAQAAPAATVAPVAAAPAAPAASVVEVKEIQV
PDIGDASNVDVIEVLVSVGDEITADQGLITLETDKATMEVPAPFAGKLLSLTVKVGDKVS
QGSVIATIETVTAGAAPAPVAQAAAPVSAAPVAAPTPASRPPVPHHPSAGTPVSTGAVHA
SPAVRRLAREFGVDLTQVAGTGRKGRIMKEDVQAYVKYELSRPKATAATSVGSGNGGGLQ
VIAAPKVDFSKFGEVEEIPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEEFRKQQN
DVAAKKKADYKITPLVFMLKAVAKTLQQFPVFNSSLSSDGESLIQKKYFHIGVAVDTPNG
LVVPVVRDVDKKGIIELSRELADISIRARDGKLKSADMQGSCFTISSLGGIGGTAFTPIV
NYPDVAILGVSKSDIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLSGILSDI
RTLVL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagtttttgttcctgatatcggcggcgatgaagtgcaagtgatc
gaaatctgtgtggctgtgggtgataccctagccgcagaagaatcgattcttaccgtcgaa
agcgacaaggcgactatggatattccagcgcctttcgccggtgttttagccgaattgaaa
gtggctgtgggcgataaagtatctgaaggtactttgatcgctatgatgcaagcggcgggc
gcggcagctgccgctccggctccagttgcagcacccgctcaggcggcaccagcatctgca
ccagttcaagcggctcctgctgctccagcagcttcggctcaagccgttgagaccaaagtg
gttgaagtgactgttcctgatatcggtggcgacactgatgtgtcaattatcgaagtgctg
gttgctgtcggtgataagattgaggttgatagcggtttaattaccctagaaacagacaag
gcgacaatggacgtaccctcacctttcgcgggtgtggttaaagacgttaaagtcgcagtc
ggcgataaagtgtcgcaaggctctttagtcatcatgcttgaagttggcggcgctgcacct
gtagccgcgccagctgcaaccgttgctgcccaagctgctcctgccgctacggtagcgcca
gtggccgcagcacctgctgcaccagcggcaagtgtggttgaggtcaaagaaattcaagtg
cctgatattggcgatgccagcaatgtcgatgtgatcgaagtgctcgtgtctgtcggtgat
gaaatcactgccgaccaaggtttgattacccttgaaactgacaaagccaccatggaagta
cctgcgccattcgccggtaaactgctgtctttgactgttaaagtgggtgacaaggtttct
caaggtagcgtcattgcgacgattgagactgtcactgcaggtgcagctcctgcacctgtt
gctcaagctgcggctccagtgagtgcggcgccagttgctgcaccaacaccagcaagccgt
cctccagtaccacaccacccaagcgcaggtacacctgtgtctaccggtgcggtacatgcg
tctcctgcggtacgtcgtttagcccgtgaatttggtgtcgatttgacccaagttgctggt
actggccgtaaaggtcgcatcatgaaagaagacgtacaggcgtatgtgaaatacgaactg
tctcgtccgaaagcgactgcggcaacctctgtgggttcaggtaacggcggcggtctgcaa
gtgattgcagcacctaaagttgatttcagtaagtttggtgaagtggaagagattccatta
agccgtatccagaagatttctggtcctaacttacaccgcaactgggtaactatccctcac
gtgactcagttcgatgaagctgatatcactgaaatggaagagttccgtaagcagcaaaac
gatgtagcggcgaagaaaaaagccgattacaagatcacgcctttagtgtttatgctaaaa
gctgtggctaaaacgttgcaacagttcccagtgttcaactcaagcttaagtagcgatggc
gaatcactgatccagaagaagtatttccacatcggtgtggcggttgatacgccaaacggt
ttggttgtgccagtcgtgcgtgacgtggataagaaaggcattatcgagttatctcgtgaa
cttgctgacatctctatccgtgcccgtgatggcaagctgaaatctgctgacatgcaaggt
agctgtttcaccatttcaagtttaggtggcatcggcggtacagcgtttacgcctatcgtg
aactacccagacgtggcgattttaggtgtgtctaaatctgacattaagcctaagtggaat
ggtaaagagttcgaacctaaattgatgttgccactgtcgctgtcatacgatcaccgtgtg
atcgatggtgctatggctgcacgctttagtgtgacgctgtcaggaattctgtccgatatt
cgtactttggttctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system