KEGG   Shewanella baltica OS223: Sbal223_3902Help
Entry
Sbal223_3902      CDS       T00803                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00860  Porphyrin and chlorophyll metabolism
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01120  Microbial metabolism in diverse environments
Module
sbp_M00121  Heme biosynthesis, glutamate => heme
sbp_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sbal223_3902
Enzymes [BR:sbp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sbal223_3902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACK48377
JGI: Sbal2233902
UniProt: B8E880
Position
4629030..4629770
Genome map
AA seq 246 aa AA seqDB search
MKVLLTRPEGRNQSMVDALNERGIAHWVTPLLCVEATPAIATNTPHPLAHADMVICISAN
AVTFADNALTTTNPPHKAWPPAQYFAVGHATWKALDQLGISALEAPDDCQQTEGLLTLAP
LQEIKGKQITIIRGVGGREALAEQLAARGAHLRYWEVYQRACPPLDGQQLALQWQAFGID
TIVVTSGEVLDNLINLVPKELFAWLRSCHIIVPSNRVEAQAHAFGITQVTNANAANSKAV
LNALKL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcttactgacgcgccccgaggggcgcaatcagtccatggtagatgccttgaat
gaacgaggcattgctcactgggtcacacctctgctgtgtgtcgaagcaacgcccgctatc
gcaacgaataccccgcatcctttggcacacgccgatatggttatctgcatcagcgccaat
gcagtgacttttgcggataacgccttaactactacaaatccaccccataaagcttggcct
ccagctcagtacttcgccgtggggcatgcgacttggaaagcattagaccaactcggtatt
tctgccctcgaagccccagatgattgccagcagaccgaagggctactcacgctcgcgccg
ctgcaagagattaaaggtaagcagattactattatacgtggtgtcggtggccgtgaagcc
ttagccgaacaactggctgcgcgcggtgcacatttgcgctattgggaagtgtatcaacga
gcttgcccgccactcgatggtcaacagttagctctgcaatggcaagccttcgggatagac
actattgtggtgaccagcggtgaagtactggataacctgattaatttagtgccaaaagag
ttatttgcatggctgcgctcatgtcatatcatagtcccaagtaaccgagtagaagctcaa
gctcacgcctttggtataacccaagtcaccaatgccaatgccgccaacagcaaagccgtg
ctaaacgcccttaaactctaa

DBGET integrated database retrieval system