KEGG   Shewanella baltica OS223: Sbal223_4237Help
Entry
Sbal223_4237      CDS       T00803                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sbp  Shewanella baltica OS223
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbp01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sbp00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5038257..5039357
Genome map
AA seq 366 aa AA seqDB search
MTDLPWKRIVVKVGSALIAPHKQGCSSHYLLGIAQFITYCRAQGIQVVLVSSGSVAAGWH
HFGEVDKPSVTVKKAMAAAGQADMMATWNKLFDFPTAQLLLTHGDLRNRDRYISIKDTIF
SLLEHGLLPIINENDAVTADKLKVGDNDNLSAMVAAAADADTLIICSDVNGLYTQNPHEN
PDAQLIKQVTEINAEIYAMAGGASSAVGTGGMRTKIQAAKKAISHGIETFIINGFDADSF
NQLLKGQNPGTLFTPDEKPMQDHLHWMTHTSQAQGEVIVENDFNISLDIHSEQLTSDDVV
AINGDFSAGDTILVRKGDGTKLAKAKSNYSSCLLSFITDQDDREFASEFQQKTGPIISEK
NIAILE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactgacttaccctggaaacgcattgtcgttaaggtaggtagtgccctgattgcaccc
cacaaacaaggttgcagcagccactacttactcggcattgcccaatttattacttattgt
cgtgcccaagggatccaagttgtcttggtctcttcgggctcagtcgccgcaggatggcat
cactttggcgaggttgataaacccagcgtcacagtgaagaaagccatggcagcagcgggt
caggccgatatgatggccacatggaacaagttatttgatttcccgaccgcacagctactg
ttaacccacggtgatttacgcaatcgagatcgttacatcagtattaaagatacgattttc
agcctactcgaacatgggctactgcctatcatcaacgagaacgatgccgtaaccgccgac
aagctcaaagttggcgataacgataatctctcggccatggtagccgcagcggccgatgcc
gataccctgattatctgttcggatgtgaatgggctttacacacaaaacccccatgaaaat
cccgatgcacagcttatcaagcaggtgaccgagattaatgccgaaatctacgccatggca
ggcggcgccagcagtgccgtcggcactggtggtatgcggactaagatacaagccgccaag
aaggcaatttcccacgggatcgaaacctttattatcaatggttttgatgctgactcattc
aaccaattgttgaagggccaaaacccaggaaccttatttacccccgatgaaaagccaatg
caagatcacttgcactggatgacacatacctcgcaggctcagggcgaagtcattgttgaa
aatgactttaatatctccctcgacatccatagcgagcaattgaccagcgacgatgtcgtt
gccatcaatggggacttttctgccggtgacaccattttagtacgcaaaggtgatggtact
aaattggccaaggccaaatccaattacagcagttgtttacttagctttattacggaccaa
gacgatcgcgagtttgccagtgaatttcagcaaaagactggaccgatcatttccgagaaa
aacatcgccattctcgaataa

DBGET integrated database retrieval system