KEGG   Shewanella baltica OS223: Sbal223_4240Help
Entry
Sbal223_4240      CDS       T00803                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbp  Shewanella baltica OS223
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal223_4240
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal223_4240
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal223_4240
Enzymes [BR:sbp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal223_4240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5042590..5043153
Genome map
AA seq 187 aa AA seqDB search
MNISIIKSNQIQPNLNSLIAEEVLAVAQVNVAEHEKIANAKQFLDRLFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFNGTKDAPCAIVLQDLGCHVELSFDRNGMIGA
RDVANLEDIQIETSLNMVVGTPESRSAASRHWLSLLHAGMSSANDTQDKLFTAKDGSDYN
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatcaattatcaagagcaaccagatccaaccgaatctaaacagcctcatcgca
gaagaagtgctagccgtggcccaagtgaatgtcgccgagcacgaaaagatcgccaatgcg
aaacaattcctcgaccgcctctttccactcaactctggttcacaccaagatgtgagcagc
tatgtggtttactatcaacacctgctggcctttttcgccgacggcagccacagcggttta
cgtcagccaaaacagtttgtggcttttaacggcactaaagatgcgccttgcgccatagtg
ttgcaggacctaggttgccacgttgaactcagttttgaccgcaatggcatgataggggcg
agagacgttgccaatctggaagatatccaaatcgaaacgtcattaaacatggtcgtcgga
acaccagagtcacgttcagccgcatcgcgccattggcttagcctgttacatgcgggtatg
tccagcgccaacgacacccaagataagttgtttaccgcaaaggatggcagcgattacaac
ttgaaaagtatcgtaaatttataa

DBGET integrated database retrieval system