KEGG   Shewanella baltica OS223: Sbal223_4299Help
Entry
Sbal223_4299      CDS       T00803                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sbal223_4299
Enzymes [BR:sbp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sbal223_4299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 DLH Peptidase_S9 Abhydrolase_5 Esterase PGAP1 UPF0227 LIDHydrolase Peptidase_S28 Lipase_3
Motif
Other DBs
NCBI-ProteinID: ACK48765
JGI: Sbal2234299
UniProt: B8EDT9
Position
5109126..5110109
Genome map
AA seq 327 aa AA seqDB search
MSQAKATFSTEHDLNTSEQQAFWQSVVQDTLITADGITLAYMMVKHPQAHTAIVLSSGRV
ESYLKYQELVFDLYQQGYSVYAIDHRGQGLSDRMTINPHMGHVRRFNDYIDDFALFMQKK
VLPQNDKQLMLLGHSMGGAIGTLYLKQHPDIFTAAAFSAPMYGIKLPMPKAFVRWLASKL
DTTLNGGEPNYVLGGQNYKPVPFKGNELTHCQSRYQAYRDLYDAAPKLQLGSPTNRWLTE
SLDAADTCVLATAQIRTPILILQASEDKIVDNAAQNLAVSTHCQLKVIAGAAHEIFMEKD
AYRNQALNYALDFFKRFAIKDEDKQAG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagccaaagcgacattttcgactgaacacgatttaaatacctcagagcagcaa
gccttctggcaaagcgttgttcaagacacgctgatcacagctgatggcatcacgctggct
tatatgatggtcaaacatccccaagcgcataccgcaatcgttctcagtagtggccgagtt
gaatcctatttaaagtatcaagaattggtcttcgacttgtaccaacagggttactctgtt
tatgccatcgatcaccgtggccaaggattgtcggatcgtatgacaattaatccgcacatg
ggtcatgtgcgaagatttaatgattatattgatgattttgcactgtttatgcagaagaaa
gtgttaccgcaaaacgataaacagctcatgctacttggccattcaatgggtggcgcgatt
ggcactttgtatctcaaacagcatcccgatatttttaccgccgcggcattttcagcgccc
atgtatggcatcaaattacctatgccaaaagcattcgtgcgctggttagcaagtaagctc
gataccactctcaatggcggcgaacctaactatgtgcttggaggacagaactataaaccg
gttcccttcaaaggaaatgagctaacccattgccaaagtagataccaagcctatcgagac
ttgtatgacgcggcccctaagttacaactcggttccccaactaaccgttggttgacagaa
tctttagatgcagcagacacttgcgtactggcaacagcgcaaattcgcacgccgatcctg
atactgcaagcgagtgaagataagattgttgataatgcagcccagaatcttgcggtgagc
actcattgtcaattgaaggtgatagcgggggctgcccatgagatttttatggaaaaagat
gcctatcgaaaccaagccttaaattatgccctcgacttctttaaacgcttcgcaataaag
gacgaggacaaacaagctggataa

DBGET integrated database retrieval system