KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101031868Help
Entry
101031868         CDS       T04350                                 

Gene name
ABHD12
Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101031868 (ABHD12)
Peptidases [BR:sbq01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101031868 (ABHD12)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101031868 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 365 aa AA seqDB search
CRLKQNLRLTGTGPAEPRCAADAGMKRALGRRKGLWLRLRKILLCVLGLYIAIPFLIKLC
PGIQAKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVTVGVWHTVPAVWWKNAQ
GKDQLWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVG
TPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILES
PFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDD
PVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRHKYIYKSPELPRILREFLGKSE
PKHQH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
tgccgtctgaagcagaacctgcgcctgaccggcacggggccggcggagccgcgctgcgca
gccgacgctggaatgaagcgggcgctgggcaggcgaaagggcctgtggttgcgcctgagg
aagatacttctctgtgttttggggttgtatattgccattccatttctcatcaaactgtgt
cctggaatacaggccaaactgattttcttgaatttcgtgagggttccctatttcattgac
ttgaaaaaaccacaggatcaaggtttgaatcacacgtgtaattactacctgcagccagag
gaagatgtgaccgttggagtttggcacactgttcccgccgtctggtggaagaacgcccaa
ggcaaagaccagttgtggtacgaggatgctttggcttccagccaccctatcattctgtac
ctgcatgggaacgcaggtaccagaggaggtgaccaccgcgtggagctttacaaggtgctg
agttccctcggttaccatgtggtcacctttgactacagaggttggggcgactcggtggga
acgccgtctgagcggggcatgacttacgacgcacttcacgtttttgattggatcaaagca
agaagtggtgacaaccctgtgtacatctggggccactctctgggcactggtgtggcgaca
aatctggtgcggcgcctctgtgagagagagacacctccagatgccctaattttggaatct
ccattcactaatatccgcgaagaagctaagagccatccattttcagtgatatatcgatac
ttccctgggtttgactggttcttccttgatcctattacaagcagtggaattaaatttgca
aatgatgaaaatgtgaagcacatctcctgtcccctgctcatcctgcacgctgaggatgac
ccggtggtgcccttccagcttggcagaaagctctatagcatcgctgcaccagctcgaagc
ttccgagacttcaaagtacagtttgtgccctttcactcagatcttggctacaggcacaaa
tacatctacaagagccccgagctcccacggatactgagggaattcctggggaagtcggag
cccaagcaccagcactga

DBGET integrated database retrieval system