KEGG   Fretibacterium fastidiosum: SY1_04430Help
Entry
SY1_04430         CDS       T02602                                 

Definition
Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sbr  Fretibacterium fastidiosum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SY1_04430
Enzymes [BR:sbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SY1_04430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
499290..500009
Genome map
AA seq 239 aa AA seqDB search
MGRPVRYNLITGSRKGEIVTLLERERNAVVEYGRRLVERGLTRGTGGNVSVLSRERRLFA
VSPSGMDYFETRPEDVVVLDMEGNVADGARRPSSEVEMHRLIYLEREDVGAVVHTHSVYA
TAVSCTREAQAGGLPPVHCAAALAGGDVRCTAYYPFGTRELAEAACEGMRGRFAVLLGNH
GVLAAGSDVGHAFALAEQLEFACEVLVHAAAVGTPALLSSSDLLAARERFRDYGQGRRE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggggcgtcccgtccgctataatttaattacaggaagcaggaagggggagatcgtcacg
ctgctcgaacgcgaacgaaacgccgtcgtggagtacggccgcaggctggtggagcgcggc
ctcacgcggggcacggggggaaacgtcagcgtcctgagccgggagaggcggctgtttgcc
gtcagtccctccggcatggactacttcgagacgaggccggaggacgtggtggtcctggac
atggaagggaacgtcgcggacggagcccgcaggccctccagcgaggtggagatgcaccgc
ctgatctacctcgaacgggaggacgtcggggccgtcgtgcacacccactccgtctacgcc
acggccgtctcctgcacgcgggaggcccaggcgggggggctgccgcccgtgcactgcgcg
gcagccctggccggcggcgacgtgcgctgcacggcctactacccctttggcacccgggag
ctggcggaggcggcctgtgaggggatgcggggacgctttgcggtgctgctggggaaccat
ggcgtcctggccgcagggtcggacgttggccatgccttcgccctggcggaacagttggag
ttcgcctgcgaggttttggtccacgcggcggccgtcggcacgccggcgctgctctcctcc
tcggacctgctggctgcgcgggagaggttccgcgactatggacagggacgccgcgagtag

DBGET integrated database retrieval system