KEGG   Fretibacterium fastidiosum: SY1_17210Help
Entry
SY1_17210         CDS       T02602                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sbr  Fretibacterium fastidiosum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SY1_17210
Enzymes [BR:sbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SY1_17210
Exosome [BR:sbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SY1_17210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1866253..1868208
Genome map
AA seq 651 aa AA seqDB search
MKQQNAVRYGVSPLTDYDIFLFKQGTHYSLYNKMGAQRFADKDGTEGVAFSVWAPNAQEV
SVVGSFNGWTPGAHPLSPRWDGSGIWEGFIPGLKRWDLYKFHLRNSRGEEKDKMDPFARS
FEVPPRTSSVVHWPEYEWGDGDWMRARPKNLSLSAPWSVYEVHLGSWRRHWDNGLSLSYR
EMAEELPAYCTDMGFTAVEFLPVMEHPFYGSWGYQMLGFFAPTSRYGTPEDFMALVDALH
RSGIAVILDWVPSHFPTDDFGLARYDGTALYEHEDPRKGYHPDWGSYIFNYGRNEVRSYL
ISSAAFWIDQYHADALRIDAVASMLYLDYSRKEGQWTPNVYGGRENLEAISLLQDLNREL
YGRFHDVQTIAEESTDWPMVTRPVFLGGLGFGMKWNMGWMHDTLDYMSLESVYRAWHQNQ
LTFSIWYAFSENFMLPLSHDEVVHGKRSLMNKMSGDWWQKRANLRLLYGYMWTHPGKKLL
FMGCELGQGLEWNNDAALEWHLLDKPEFRGIQQWVRDLNGALKQYPPLHERDFSPAGFRW
VDCTDWQQSVIAWLRMGERRDEYVLCAANFTPVPREGYRVGVPCGGFWREVLNSDATVYG
GSGMGNKGGMEAETIPCHNLPCSLPLTLPPLAIVVFHFTGAPSSEGPQGKA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcaaaacgcagtgcgttacggtgtttcccccctgaccgactacgacatcttc
ctgttcaagcaggggacccactacagcctctacaacaagatgggagcccagaggtttgcg
gacaaggacgggacggagggcgtggcgttctccgtgtgggcgcccaacgcccaggaggtc
agcgtggtgggcagcttcaacggctggacccccggcgcccacccgctctccccccgctgg
gacgggagcggcatctgggagggcttcatccccggcctcaagaggtgggacctctacaag
ttccacctcaggaacagccgcggcgaggagaaggacaagatggaccccttcgcgcgctcc
ttcgaggtgccgccccgaacctcctccgtcgtccactggccggagtacgaatggggcgac
ggcgactggatgcgggcccggccgaagaacctctccctctccgccccctggtccgtctac
gaggtccacctgggctcctggcggcgccactgggacaacggactctccctctcctaccgc
gagatggcggaggagctccccgcctactgcacggacatgggcttcacggccgtggagttc
ctgcccgtgatggaacaccccttctatggctcctgggggtatcagatgctgggcttcttc
gccccgacgagccgctacgggacgccggaggacttcatggccttggtggacgccctgcac
cgcagcggcattgccgtgatcctggactgggtgcccagccacttcccgaccgacgacttc
ggcctggcccgttacgacggcacggcgctctacgagcacgaggacccgcgcaagggctac
caccccgactggggcagctacatcttcaactacggccgcaacgaggtgcgcagctacctc
atctcaagcgccgccttctggatcgaccagtaccacgcggacgcgctgcgcatcgacgcc
gtagcctccatgctgtacctggactactcccgcaaggaggggcagtggacgcccaacgtc
tacggcgggcgcgagaacctggaggccatctccctgctccaggacctgaaccgcgagctc
tacgggaggttccacgacgtccagaccatcgcggaggagtccacggactggcccatggtc
acgcggcccgtgttcctgggcgggctggggtttggcatgaagtggaacatgggctggatg
cacgacaccctggactacatgagcctggagagcgtctaccgcgcctggcaccaaaaccag
ctgaccttcagcatctggtacgccttctccgagaacttcatgctgcccctgtcccacgac
gaggtggtgcacggcaagcgctccctcatgaacaagatgtcgggcgactggtggcagaag
cgggcgaacctgcgcctgctctacggctacatgtggacgcaccccggcaagaaactgctc
ttcatgggctgcgagctggggcaggggctggagtggaacaacgacgcggcgcttgagtgg
cacctcctggacaagccggagtttcgcggcatccagcagtgggtgcgcgacctgaacggc
gcgctgaagcagtaccccccgctccatgagcgggacttcagcccggcgggcttccgctgg
gtggactgcaccgactggcagcagagcgtcatcgcctggctgcgcatgggcgagcgcagg
gacgaatacgttctctgcgcagcgaacttcacgccggtaccccgcgagggctaccgcgtg
ggggtcccctgcggcggcttttggcgcgaggtcctgaacagcgacgcgaccgtctacggc
ggaagcggcatgggcaacaagggggggatggaggcggagacgatcccctgccacaacctg
ccctgctcgctccccctcacccttccgcccctcgcgatcgtggtctttcacttcacgggg
gccccgtcctccgaaggaccccagggaaaggcgtag

DBGET integrated database retrieval system