KEGG   Shewanella baltica OS117: Sbal117_0475Help
Entry
Sbal117_0475      CDS       T02013                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sbs  Shewanella baltica OS117
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal117_0475
Enzymes [BR:sbs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sbal117_0475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(522773..523423)
Genome map
AA seq 216 aa AA seqDB search
MALSEAAVKVQAALLERGLETPMLPSVYSSEERKDKIEHHMKEILTLMSLDLSDDSLADT
PRRIAKMYVDEIFSGLDYANFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTAT
IAYLPRKKIIGLSKINRIVRFFAQRPQVQERLTQQVLVALQTLLETKDVAVKMDAVHYCV
KSRGVMDSTSSTTTTALGGIFKSNPATRAEFLHQSK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtgaagcagcagtaaaagtacaagccgcgttattagaacgtggacttgaa
accccaatgctcccaagcgtttacagcagtgaagaacgtaaagacaagattgaacatcat
atgaaagaaatcctgacattaatgtcattggatctgtcagacgatagccttgccgatacg
ccgcgccgcattgctaaaatgtacgtcgatgaaatcttctccggcttagattatgcgaac
ttccctaagatcacggttatcgacaataagatgggcttcgatgaaatggtgcgagtgcaa
gacattagcctcaccagcacctgcgaacaccatttagtgacgatcgatggtactgcgacc
atagcttatctaccacgcaaaaaaatcattggtttatcaaagattaatcgcatcgtgcgt
ttctttgcccaacgtccacaagtgcaagagcgtttgactcagcaagtgttagtcgcactg
cagaccttgctcgaaactaaagacgttgcggttaaaatggatgctgtgcattactgcgtc
aaatcccgtggcgtgatggactcaaccagttcgaccactaccacagcgctgggcggcatt
ttcaaatctaaccctgcgacccgcgccgagtttttgcaccagtctaaataa

DBGET integrated database retrieval system