KEGG   Shewanella baltica OS117: Sbal117_0494Help
Entry
Sbal117_0494      CDS       T02013                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sbs  Shewanella baltica OS117
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sbs00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
544713..546197
Genome map
AA seq 494 aa AA seqDB search
MQKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGWVEHDPMEIWASQSSVL
VEVLARAGIHSDEVAAIGITNQRETTVIWEKATGKPIYNAIVWQCRRSSEICEQLKAQGL
EEYVRENTGLLLDPYFSGTKIKWILDNVPNARAQAERGELLFGTIDTWLVWKLTEGKVHV
TDPTNAARTLLFNIHSLTWDNKLLEALDIPLSLLPEVKPSCSVYGTTRIAGEGSEIQVAG
MAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGTKAVRSNHGLLTTVAVGPKGEVNYA
LEGSVFMGGATIQWLRDELGLIRDASDTEYFASKVADTNGVYLVPAFVGLGAPYWDPNAR
GALFGLTRGANRNHIIRAALESIAYQSKDLLDAMTKDSGVSLKRLKVDGGAVANDFLMQF
QADITDVEVLRPSVCETTALGAAFLAGLAVGFWESVIELEHKACIDKHFIPNIDAETRVR
LYAGWQDAVARTRA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaaaaatacgtggtggccttagatcaaggcacgaccagctcaagggcgatagtg
ttcgatcacgacgcaaacattgtcagcgtgtcccagcgggaattcacccagttgtatcca
aatccgggttgggtcgagcatgatcccatggagatctgggcaagccaaagttcagtgtta
gttgaagtgctggcgcgcgcggggatccacagcgatgaagtggctgcaattggcattacc
aatcagcgggaaaccactgtcatttgggagaaagccacaggtaaacctatctataacgcg
attgtgtggcagtgccgtcgcagctctgaaatttgtgagcaactcaaagctcaaggatta
gaagagtatgtgcgtgaaaacacaggtctattactcgacccttatttttcaggcactaag
atcaagtggattctagataatgtgcccaatgcccgtgcgcaagccgagcgcggtgagttg
ttgttcggcactatcgatacttggctagtgtggaagttaaccgagggcaaagtgcatgtc
accgaccccaccaatgccgcccgtactctgctgtttaatatccatagcctgacttgggat
aacaagttacttgaagctttagacattcccttgtctttgttgcccgaagttaagccttcc
tgcagcgtgtatggcactacgcggattgccggtgaaggcagtgaaattcaagtcgcaggg
atggcaggcgaccaacaagcggcgctttttggccagctgtgtgtcgagcccggcatggcg
aagaatacctatggcactggctgttttttgttgatgaataccgggaccaaagcggtgcgt
tccaaccatgggttactgaccacagttgccgtggggccgaagggcgaagtgaactatgcc
ctcgaaggctcagtcttcatgggcggcgcgaccattcaatggctgcgggatgaactgggg
cttattcgtgacgccagtgatactgagtattttgcctctaaggttgcagataccaatggc
gtatatctggtgccagcctttgtgggactcggtgcgccctattgggatcccaatgcccgt
ggcgcactatttggtttaacccgtggcgccaaccgtaatcatattattcgggcggcgtta
gaatccattgcttatcagagtaaagatttactcgatgccatgaccaaagacagtggcgtt
agccttaagcgtttaaaggtggatggcggcgcggtcgccaatgattttttgatgcagttt
caagccgatatcaccgatgtcgaagtattaaggccgagtgtttgtgagacaacggctttg
ggcgcggcatttttagctgggctggcagtgggcttttgggagagtgtcattgagcttgaa
cataaggcttgtatcgataagcattttatccccaatattgatgccgagactcgggtgcgg
ttatacgcaggttggcaggatgccgtcgccagaactcgcgcctaa

DBGET integrated database retrieval system