KEGG   Shewanella baltica OS117: Sbal117_0500Help
Entry
Sbal117_0500      CDS       T02013                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sbs  Shewanella baltica OS117
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sbal117_0500
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sbal117_0500
Enzymes [BR:sbs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Sbal117_0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
550957..552456
Genome map
AA seq 499 aa AA seqDB search
MMLLRDLLAPWLHYAGAQSFNDLTLDSRAIRRGDVFLALPGHKVDGRQFIEKVLDLGAAA
VLVHTDDADQHGKVLHSDNAEHGVQIYFFQLSRQVSAIAAQRYPLAHQSATTSLGVIGIT
GTNGKTSTSQLIAQLITSLGRKAAVMGTLGNGLWGELVDSGNTTADAITLMRQLHDFEAQ
GASVCAMEVSSHGLVQGRVDAVSFDVAVFTNLTRDHLDYHGDMESYAAAKQSLFRFSTLG
HGLLNLDDAVGASWLTELKSVPAQMWGFSIEGHQAAAFYTKNAKFDDQGVSATLVWPEGE
TEIHSPLLGAFNLSNLLAALSALYLQGFDMKALAEQVQYLTPVAGRMERFTTANNITLVV
DYAHTPDAIEQALNALRRHCAGDLWCVFGCGGDRDKGKRPLMGKAAEQYADRIMVTSDNA
RSEDPAQIITDIIQGLTHPQQALTQVDRIAAIKEVVALAKPGDVILLAGKGHETYQEAAG
VRHDYDERALARQLSEQSR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgatgttattacgggatctgcttgcgccttggctgcattatgccggcgcgcagtccttc
aacgatttgaccttagatagccgcgcaatacgtcgcggcgatgtgtttttggcgctgcca
ggacataaggtcgatggcagacagtttattgaaaaagtcttagatttaggtgccgcagcc
gtattagtccacacggatgatgctgatcagcatggcaaagtgttgcacagcgataatgcc
gagcacggcgtgcagatttatttcttccagttgagtcgccaagtatcagccatcgccgcc
cagcgttatcccttagcgcatcagtctgcgacaacatcccttggggtgattggtattact
ggcaccaatggtaaaacctcgacaagccaactgattgcccagctgataacgtcgctcggc
cgcaaagccgccgtgatgggcacccttggcaatggtctctggggcgagctcgtcgatagc
ggtaacaccacagccgatgctattaccctaatgcgtcagttgcatgactttgaagcccaa
ggcgcgagtgtctgcgccatggaagtgtcgagccacggcttagtgcaaggccgcgtcgat
gcagtatcattcgatgttgccgtgtttaccaatctgacgcgcgatcacctcgattaccac
ggcgacatggaaagctatgccgccgctaagcaaagcctatttcgtttcagcaccttaggt
cacggtttattgaatcttgacgacgcggttggtgcatcttggttgactgaacttaaatct
gtgcccgcgcaaatgtggggctttagtattgaaggtcatcaagccgcggctttttatacc
aaaaatgccaagtttgacgatcaaggtgtcagtgcaaccttagtgtggcccgagggcgaa
actgaaattcactcaccactacttggtgcctttaatctttctaatttactcgcggcgctc
tcagccttgtatctgcaaggttttgatatgaaagcgttagccgagcaagtgcaataccta
acgcccgtcgcaggtcgtatggagcgtttcacaactgcgaataacatcaccttagtggtc
gattatgcccatacgccagatgcgattgaacaagcgttaaacgcgctacgtcgccattgt
gccggtgatttatggtgcgtatttggctgtggtggcgaccgtgataagggcaagcgtcct
ttgatgggcaaagccgcagagcaatatgctgaccgcattatggtgacgagcgacaatgcg
cgcagtgaagaccccgcgcaaattattaccgatattatccaagggctaacccatcctcag
caggcattgactcaggttgaccgtatcgcagcaattaaagaggttgtggcattggcgaaa
cctggcgatgtgatcttgcttgcgggcaaaggccacgaaacttaccaagaggcggcaggt
gtgcgtcatgactatgatgaacgcgccctggcacgccagttatcggagcaatcaagatga

DBGET integrated database retrieval system