KEGG   Shewanella baltica OS117: Sbal117_0748Help
Entry
Sbal117_0748      CDS       T02013                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
sbs  Shewanella baltica OS117
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal117_0748
   00670 One carbon pool by folate
    Sbal117_0748
Enzymes [BR:sbs01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Sbal117_0748
    1.5.1.-  
     Sbal117_0748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
841802..842548
Genome map
AA seq 248 aa AA seqDB search
MTSPIIITGVGKRIGYALAKHFLAQGQQVIGTYRSHYDSIDELNALGATLYPCDFYDDTQ
VQSLIDELTQLPQIRAIIHNASDWLPDPVLTKNEPLKSTTFAPSQVLQRMMQVHVSVPYQ
LNLALEAQLRAAAGDEIGGSDVIHITDYVAEKGSQKHIAYAASKAALHNLTLSFAAKFAP
EVKVNSIAPAMILFNTGDDAAYQQKTLAKALLPKEAGNAEIIELVDYLLNSRYVTGRCHN
VDGGRQLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcccatcataatcacaggcgtgggtaaacgcataggttacgccttagccaaa
cattttctcgcccaaggtcagcaggtgattggtacttatcgcagccattacgatagcatt
gatgagctgaacgctttaggtgcgactctgtatccctgcgatttttatgacgatacccaa
gtgcaatccttaattgatgagttaactcaactgcctcaaattcgcgccattattcacaat
gcctcggactggctgcctgatcctgttcttacaaagaatgagcctttaaagagtaccact
tttgcaccgagccaagtgctgcagcggatgatgcaagtgcatgtgagcgtgccctatcag
ttgaacttggccttagaggcgcagctacgtgccgctgctggcgatgaaatcggcggcagt
gatgtgattcatattaccgattacgtggcagagaagggcagtcagaagcacatagcttac
gccgccagtaaagccgcgctgcacaatttgacgttatcctttgccgccaaatttgcgccc
gaggtgaaagtgaattcgattgcgccggcgatgattctctttaataccggtgatgacgcc
gcctatcagcaaaaaaccttagcaaaagcgctgttgccgaaagaggcggggaatgcggag
attattgaactcgtggactacctgcttaatagccgttacgtcacaggtcgttgccataat
gtcgatggcggccgccagttaaaatag

DBGET integrated database retrieval system