KEGG   Shewanella baltica OS117: Sbal117_0940Help
Entry
Sbal117_0940      CDS       T02013                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sbs  Shewanella baltica OS117
Brite
Enzymes [BR:sbs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Sbal117_0940
Secretion system [BR:sbs02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sbal117_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1056360..1057085
Genome map
AA seq 241 aa AA seqDB search
MKLTRALSLIFALVVAPLANAATATSPDTAAIKQKLTEMLDVEVISMQDSPIEGLYQAMT
NRGVLYISRDGSKLFHGSLYDLDKGMKNLTEAALAGPRLEMMKPLEDHMLVYKAKNEKHV
VTVFTDVSCGYCRKLHSQMADYNKLGITVRYLAFPRAGVPSANADEMQAIWCAKDPLKAM
TDAKAGSKVAAATCDAKIAEQYALGTTFGVNGTPAIVLEDGNMIPGYQPPADLLRTLEAR
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaacccgagcattatctttaatttttgcccttgttgtagctcctcttgctaac
gccgcaacagcgacctcgccagatacagctgctattaagcaaaaactgactgagatgttg
gatgttgaagtcatttctatgcaggattcgccgattgagggtttgtatcaagccatgacc
aaccgcggcgtgctctatattagtcgtgatggttcaaaactgttccacggcagtttgtat
gacctagataaaggcatgaaaaacttaactgaagcggcattagctggcccacgtttagaa
atgatgaagccgcttgaagaccatatgttggtttacaaagctaaaaatgaaaaacatgtg
gtcactgtatttactgacgtcagctgtggttattgccgtaaattgcacagccaaatggcc
gattacaacaagcttggcattaccgtgcgttacttagcctttccgcgtgcgggcgtgccg
tcagccaacgccgacgaaatgcaagccatctggtgtgctaaagatccattaaaagccatg
acagacgctaaagcgggcagcaaagttgccgcagcaacatgcgatgctaaaattgccgag
caatatgctttaggcaccacctttggtgtgaatggtacgcctgcaatcgtgttagaagat
ggcaatatgatcccaggttatcaaccccctgcggacttattacgcaccttagaagcgcgt
cagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system