KEGG   Shewanella baltica OS117: Sbal117_0981Help
Entry
Sbal117_0981      CDS       T02013                                 

Definition
hypothetical protein
Orthology
K09859  
hypothetical protein
Organism
sbs  Shewanella baltica OS117
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1112974..1114377)
Genome map
AA seq 467 aa AA seqDB search
MKLSLVTPLSRAFIAPALAMGLVLSLSGCAYNSIFINYPSQIEPLKQELNSATPLADIDK
LASNINGNDGLLYAQEAGRIAQVAGDFAASKKYYQQAVDAYTAFDDKAKVSVSDISATAS
SLVLNDNAIPYRGPGYERIMLHQYQALNYLFSGDYQGALVEVRRSNELQSSEQERYQKSQ
KSVQAMANGTIDAEVNKLGQAAGTVTSSFLNAYSYYTTGVLHEVLGEPNDAYIDYRKAAQ
ITPDNTYLQQDLVRLAKQLGMPQYDEFKRRWGDAKLPNPKDGQVILMVERGFVPAKQALT
VPFTIHGNWQTVSLATYMPNNTFVPETQVQGLGTVLKTEPIANIDALAITALKEDLPATL
VRQVARVYAKSEMAYQVGKSGSPGNNAADIGSIAMQIFNVVTEQADRRSWLTLPKQAQIG
RRYLSAGEYTLQLDKAPPAKIDVAAGKTTLVWAIDTGNYTRIYSIII
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtctttggttacacctttatctcgcgcgtttatcgcccccgctttggcaatg
gggttggtgttaagtttatcgggctgcgcctacaacagtatttttattaattacccttca
cagattgaaccgctcaaacaagagttgaatagtgcaacacccttggccgatatcgacaaa
cttgccagcaatatcaatggcaacgatggcctactctatgctcaagaagcgggccgtatt
gctcaagtcgccggcgattttgcggccagtaaaaagtactatcaacaagcggtcgatgct
tacaccgcctttgatgataaagccaaagtcagcgtcagcgacattagtgccactgccagc
agcttagttttaaacgacaatgcgattccgtatcgtggacctgggtatgaacgcatcatg
ctgcaccaataccaagcccttaactatttgtttagtggcgattaccaaggcgctttagtc
gaagttcgtcgcagtaacgagttacaaagcagtgagcaagagcgctatcaaaaatcgcaa
aagtcggtacaagccatggcgaacgggactatcgatgccgaggtcaacaaactaggccaa
gccgcaggcactgtgacgagttctttcttaaacgcttacagctattataccactggcgta
ttacatgaagtgctgggtgagccgaacgatgcctatatcgattatcgtaaagcggcacaa
atcaccccagacaacacctatttacagcaagatctggtgcgtctcgccaagcaactcggc
atgccgcaatatgatgagttcaaacgtcgttggggcgatgctaaattgcctaatcccaaa
gatggccaagtgattttaatggttgaacgcggctttgtgcccgccaagcaagccctcacc
gtgccttttactatccatggcaattggcaaactgtatcgctagccacttacatgccaaac
aatacttttgtgccagagacgcaagtgcaaggtttaggtacagtgctgaaaactgaacct
attgccaatattgatgccttagccatcacggcactcaaggaagatctgcccgcaaccttg
gttcgccaagtcgcacgtgtctatgccaaatctgagatggcctatcaggttggaaagagt
ggcagccccggaaacaatgccgccgatattggcagcatagcgatgcagatttttaacgta
gtaacagagcaagcggatcgccgtagttggctgacgctgcctaaacaagcacagatcggg
cggcgttatttgagtgcgggagaatacactttgcagttagataaagcgccaccggcaaaa
attgacgttgcagcaggcaaaaccaccttagtctgggcaattgatactggtaattacacc
cgaatttattcaataatcatttag

DBGET integrated database retrieval system