KEGG   Shewanella baltica OS117: Sbal117_1421Help
Entry
Sbal117_1421      CDS       T02013                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00630  Glyoxylate and dicarboxylate metabolism
sbs01100  Metabolic pathways
sbs01110  Biosynthesis of secondary metabolites
sbs01120  Microbial metabolism in diverse environments
sbs01200  Carbon metabolism
Module
sbs_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal117_1421
Enzymes [BR:sbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Sbal117_1421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEH13182
Position
1600730..1602055
Genome map
AA seq 441 aa AA seqDB search
MTKATTQNSRQEQIDAIKRDWAENPRWKNVRRPYTAEEVVALRGSIVPENTIAKRGAAKL
WELVNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYP
ANSVPAVVSRINNSFRRADQIQWGNGVNPEDEKFVDYFLPIIADAEAGFGGVLNAFELMK
SMIDAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVDTLVIART
DANAADLLTSDCDPYDRDFVTGERTNEGFYRVKAGLDQAISRGLAYAPYADLIWCETAKP
DLEEARVFAEAIHAQYPDQLLAYNCSPSFNWKKNLDDATIARFQQALSDMGYKYQFITLA
GIHNMWYNMFDLAYDYARGEGMKHYVEKVQEVEFAAAKKGYTFVAHQQEVGTGYFDQVTT
VIQGGHSSVTALTGSTEEEQF
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggcaacgactcagaattcacgtcaagagcagattgatgcaatcaagagagat
tgggcagaaaacccacgttggaaaaacgtgcgtcgtccttacaccgcggaagaagtggtt
gcacttcgcggttcaatcgtgcctgagaatactattgccaagcgtggtgcggctaagtta
tgggaactggttaacggcggcgctaaaaaaggctatgtgaattcgctcggtgcgttaacg
ggcggtcaagcggtacaacaggcgaaagcgggtatcgaagcgatttacctttctggttgg
caagtggctgcagatgctaacttagccggcactatgtacccagatcaatctttataccca
gcgaactcagtgccagctgtggtatcccgtatcaataactctttccgccgtgctgaccaa
attcaatggggcaatggcgttaatccagaagatgaaaaatttgttgattacttcctgccg
attattgctgatgcagaagcgggttttggtggcgtattaaatgccttcgaactgatgaag
tcgatgatcgatgcgggcgctgccggcgttcactttgaagatcagttagcttcagtgaag
aaatgtggtcacatgggcggcaaagtattagtgccaacccaagaagcggtacaaaagctg
gttgctgcacgtttagcggcggatgtgagcggtgtggatacactggttatcgcccgtacc
gatgctaacgcggccgatttgttaacttcagattgcgacccatacgaccgtgatttcgtg
actggcgagcgtactaatgaaggtttctaccgtgttaaagcgggtcttgaccaagcgatt
tctcgcggtcttgcctatgccccgtatgcggatttgatttggtgtgaaaccgctaaaccg
gatcttgaagaagcgcgtgtttttgctgaagcgattcatgctcagtacccagatcaactg
ttagcgtataactgttcgccttcgttcaactggaagaaaaatctggacgacgccactatc
gcgcgcttccaacaagcattgtcagacatgggctacaagtaccagttcatcactttagcc
ggcatccacaacatgtggtacaacatgttcgacctcgcttacgactatgctcgtggcgaa
ggcatgaagcattatgttgagaaagttcaagaagttgagtttgctgcagcgaagaaaggt
tacaccttcgtcgcgcatcaacaggaagtgggcacaggttattttgaccaagtgactacg
gttattcaaggtggccattcatcagtgaccgcactgacaggttctaccgaagaagagcag
ttttaa

DBGET integrated database retrieval system