KEGG   Shewanella baltica OS117: Sbal117_1434Help
Entry
Sbal117_1434      CDS       T02013                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sbs  Shewanella baltica OS117
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sbal117_1434
Enzymes [BR:sbs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Sbal117_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1615861..1618287
Genome map
AA seq 808 aa AA seqDB search
MGLEKLLYLRGVGAEFTDCFGQEIHISEVDRQGILTCMLQEKNTVAGTAIDASATEVLSS
DAGLTNVDVVLTEALIASQIDLLDARPWTQVLPEFHWCFVDEPWISLCLPETYTSDLSVA
IECEQGESIVFDVPFSALKSIGDYRIEQTLYLHYRLDLTQLGLARLDLAEAKTQASPEHS
MPVETEAVNLASYFLSSQEFTNNPALIKNQDSFAHAADKNASDFSVLGLGFHRIALSLKH
ALETSAPAPSSALQSSVMAEADTSTLFSGTLMVAPRAAYQGVLTAVAQGKRHKPWGISVQ
LYSLRSESQWGIGDFGDLEQLIALVAAQGADFIQLNPLHALDIAAPEHPSPYSPCDRRRL
NPLYIQLQSVPEYQALTTEFSSATWLEAIALLNRDNWLDYPKVSELKYRAFEQLYRVFCE
THLANDTPRAQRFHEFVREHGTALQEFAQAEYLRSPKAFVQEEGFYLYLQFVAENQLHLC
QLKAKEVGMGLGLIRDLAVGAALQGSEVQANAEQFCLNASIGAPPDSFAPQGQNWGLTPL
DPVKLKQHNFSHFIALIRANMESCGALRIDHVMGLLRLWWWPLDKQLGHGAYVYYPVETM
LAIVCLESQRARCVVIGEDLGLVPPDIIHRLYTSGIYSNELFYFCKDHQGFKSPDQYKSQ
SLMMLANHDVPTLVAWWCGSDLHLRRQLSLFDSDEQLGDALAGREHEKQQLISLLVAQGL
LAEVTIAELDIQTLLTAWMTLGARGNSALYSVQLCDLLADRHAVNIPGTWLEYPNWQRRL
PLSLTQVSTSPEILQRLQNIAAARQLPS
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggggctggaaaagttgctgtatttgcggggggttggagcagaatttactgattgtttt
ggccaagagatccatatttccgaggtagacaggcaaggtatcttgacctgtatgttacag
gaaaaaaacactgtggcagggactgccattgatgcttctgctacagaggtgttatcgagt
gatgctgggctgactaacgtcgatgtggtattgaccgaagcgctgatcgcctcacaaatt
gacttgctggatgcccgtccttggactcaggtgttacccgaattccattggtgtttcgtg
gatgaaccttggataagcctttgtttacctgaaacctatacctcagatctgagtgtggcg
attgaatgcgaacagggtgagtctatcgtatttgatgtgccgttctcggcgcttaagtcg
attggcgattaccgtattgaacaaacgctttatctacactatcgccttgatcttacgcaa
ctgggattagcacgcctcgatttagctgaggctaagacccaagcttcccctgaacattca
atgcccgtcgagactgaggcggtaaatttagcgtcttatttcctgagcagccaagagttc
actaacaacccagccttaatcaaaaaccaagactcatttgcgcatgcagctgacaaaaat
gcgagtgatttctctgtgttaggtttgggctttcatcgtatagctttaagcttaaaacat
gctctagagaccagtgcaccagcgccaagctcagcgctacagagcagtgtgatggctgag
gctgataccagcactttgttttctggcaccttaatggtggcaccgcgggccgcttatcaa
ggcgtactcacggctgtcgcccaaggtaagcgccataaaccttgggggatcagcgttcaa
ctctacagtttacgcagcgagagccagtggggcataggtgactttggcgatttagaacaa
ctgatcgcgctggtggcggcgcagggcgcggatttcattcaactcaatcccttgcatgcc
ctcgacattgcggcgccagagcatccgagtccctatagtccgtgcgatcgccgcagactt
aatcctctttatattcaattacaaagcgttcctgaataccaagcacttaccactgaattt
tcaagcgctacttggctagaggccatcgccttactgaatcgtgacaattggctcgattat
cctaaggtgagtgagctcaaataccgtgcctttgagcagttatatcgcgttttttgtgaa
acccatttagcaaacgacacgcccagagcgcaaagattccatgagtttgtgcgtgagcat
ggcactgcgctgcaagagtttgctcaagcggaatacttacgtagcccaaaagcgtttgta
caagaggaaggtttctatctttacctgcaatttgtggccgaaaaccagttacacctttgc
cagctaaaagcgaaagaagtgggtatggggttgggattaatccgtgatttggccgttggc
gcagcgctgcagggcagtgaagtacaggccaatgccgagcagttttgtttgaatgccagt
atcggcgcaccgccggattcctttgcgccccaagggcaaaattggggcttaacgcccctc
gatccggtgaagttaaaacaacataatttcagtcattttatcgccttgatccgcgccaat
atggaaagctgtggcgccttgcgtatcgatcacgtgatgggcttactgcgcctctggtgg
tggccactggataaacaacttggccacggtgcctatgtgtattatcccgttgaaaccatg
ctcgccatcgtttgccttgagagtcaacgcgcccgctgtgtggtgattggtgaagactta
gggctagtgccaccggacattattcatcgtctctacacctcaggcatttactccaacgaa
ttgttctatttctgcaaagaccatcaaggctttaaatcaccggatcaatataagtcccag
agcctgatgatgctggcgaaccacgatgtgccgaccttagtagcttggtggtgtggcagc
gatttacacctgcgtcgacagttatccctatttgattctgacgaacaattgggcgatgcg
ctcgcagggcgggagcatgaaaagcagcagcttatttcactgttagtcgctcaaggtctg
ttagccgaggtgacgatagccgaactcgatattcaaaccttgctcacggcttggatgacc
ctaggggctcgcggaaatagtgcgctgtacagcgtgcaactgtgtgatttattggccgat
cgccatgcggtgaacattcccggcacttggctcgaatatcctaactggcagcgccgcttg
ccgctgagtttaacgcaagtgtcgacttcgccagagatactgcagcgattacaaaatatc
gctgcggcgagacagctaccgagttaa

DBGET integrated database retrieval system