KEGG   Shewanella baltica OS117: Sbal117_1583Help
Entry
Sbal117_1583      CDS       T02013                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sbs  Shewanella baltica OS117
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sbs00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1815279..1816085
Genome map
AA seq 268 aa AA seqDB search
MTNKTTIAQTLTKQDLLQVVAIAKTAGDAIMTVYGQDDFSVSHKGDDSPVTAADLAAHHV
IVAALAQQFVGIPIMSEEAADIAWDERRQLQTYWLIDPLDGTKEFIKRNGEFTVNIALIH
QGVAIAGVVYAPVLDTYYYGAKHLGAWRQQTGQESPLLGAKVPRAMPMIVGSRSHLSPGL
AQYLQQFGEHDILSVGSSLKFCMLAEGSADLYPRLGPTSEWDTAAAQAVLESAGGTVVCY
ESGEPLTYNQKPDILNPYFIATAPGWVK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaacaagacgacaatagcacagacattgaccaaacaagatctactgcaagtggtc
gcgattgccaaaacggcgggcgatgccattatgacggtttatggtcaagatgacttttcg
gtgagccacaagggcgacgatagtcccgtgacggccgccgatttagccgcgcaccacgtg
atagtggcggcattggcgcagcagtttgtcggtattcctattatgtctgaggaagcggcg
gatattgcctgggatgagcgtcgtcaattgcaaacctattggttaattgaccctttagat
ggcactaaggaatttattaagcgcaatggcgagtttaccgtcaatattgcgcttatccat
caaggggttgctattgcaggtgtggtttatgcgcctgtgctcgatacctattattacggc
gctaagcatttaggtgcatggcgtcaacaaacgggtcaagaaagtcccttattgggcgct
aaagtgccacgtgcgatgccgatgattgttggcagccgctcgcacttgagcccaggttta
gcgcaatatttacaacagtttggcgagcatgacatcttaagcgtgggtagctcgcttaag
ttttgtatgttggcagaaggcagtgccgatctgtaccccagactgggccctaccagcgag
tgggacactgcggcggcgcaagctgtgctcgaaagtgcaggcggcacagttgtctgttat
gagtcaggtgaaccattaacttataatcaaaaacctgacattttaaacccttactttatt
gccacagccccaggctgggtgaaataa

DBGET integrated database retrieval system