KEGG   Shewanella baltica OS117: Sbal117_1592Help
Entry
Sbal117_1592      CDS       T02013                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00040  Pentose and glucuronate interconversions
sbs00052  Galactose metabolism
sbs00500  Starch and sucrose metabolism
sbs00520  Amino sugar and nucleotide sugar metabolism
sbs01100  Metabolic pathways
sbs01130  Biosynthesis of antibiotics
Module
sbs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sbal117_1592
   00052 Galactose metabolism
    Sbal117_1592
   00500 Starch and sucrose metabolism
    Sbal117_1592
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal117_1592
Enzymes [BR:sbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sbal117_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEH13351
Position
complement(1825119..1826027)
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDEASCDLRRDNLAAMVALFDETQVGQIMVEGVPHNVVNQYGI
ADVNGHDLQPGESEPLVELVEKPAVDEAPSNLAVVGRYVLPASIWPLLAKTPAGAGDEIQ
LTDAIAMLMKQETVNAYYMEGKSHDCGNKQGYMRANVEYALRHSEIGEDFAQYLKTVVKG
MK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcctgtcgcaggcctaggcactcgtatg
cttccagcgaccaaagcgattccaaaggaaatgttaccggttgtcgataagccattgatc
caatatgtggtcagtgaagctatcgcagctgggatcaaagaaattgtcctagtgacccac
gccagtaaaaactctatcgaaaaccacttcgataccagtttcgaattagaagcccaactc
gagcgccgcgttaaacgtcagttactcgaagccgtacaatctatctgccctaaagacgtg
acggtgatcagcgtgcgtcaatctcaggcgaaaggattaggccacgccattttgtgcgca
aaatcagtcgtcggcgatgcaccatttgcagtattactgccggatgtgatcatcgatgaa
gccagctgtgatctgcgtcgcgataacttagccgctatggttgcgctgtttgatgaaacc
caagtgggtcaaatcatggttgaaggcgtgccgcacaacgtcgtcaatcagtacggtatt
gctgatgtgaatggccatgatttacaacctggtgaatctgagccattagttgaattggtt
gagaaaccagccgtggatgaagcgccatctaacttagccgttgtaggccgttatgtatta
cctgccagcatttggccactactggctaaaacccctgcgggcgctggcgatgaaattcaa
ttaacggatgcgattgccatgttaatgaaacaagaaaccgtgaacgcttattatatggaa
ggcaagagtcacgactgtggtaacaagcaaggttacatgcgcgcgaacgttgaatatgct
ctgcgccacagcgaaatcggtgaagattttgcacaatatttaaaaaccgttgtaaaaggg
atgaagtaa

DBGET integrated database retrieval system