KEGG   Shewanella baltica OS117: Sbal117_1869Help
Entry
Sbal117_1869      CDS       T02013                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00010  Glycolysis / Gluconeogenesis
sbs00620  Pyruvate metabolism
sbs00640  Propanoate metabolism
sbs00680  Methane metabolism
sbs01100  Metabolic pathways
sbs01110  Biosynthesis of secondary metabolites
sbs01120  Microbial metabolism in diverse environments
sbs01130  Biosynthesis of antibiotics
sbs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal117_1869
   00620 Pyruvate metabolism
    Sbal117_1869
   00640 Propanoate metabolism
    Sbal117_1869
  Energy metabolism
   00680 Methane metabolism
    Sbal117_1869
Enzymes [BR:sbs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sbal117_1869
Lipid biosynthesis proteins [BR:sbs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sbal117_1869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEH13614
Position
complement(2141467..2143419)
Genome map
AA seq 650 aa AA seqDB search
MSSQSLYKVSGNIAANALVNNDKYKTMYQESIVNPEGFWREHGKRIDWIKPYTKIKKTSF
DDHNLSINWFYDGTLNASANCLDRHLAEHSDRVAIIWEGDNASEQRKITYGELHADVCKF
ANALRSQGVRRGDIVTIYMPMVPEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKS
KVIITSDEGMRGGRAIPLKRNIDDALKNPDVTTVEKVIVLKRTGGKVDWVEGRDVWWHSL
METASEYCQPEEMDAEAPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKAGEV
YWCTADVGWITGHSYMVYGPLANGATVLIHEGVPNHPSPARLGEMIDRHKVSILYTAPTL
IRALMAEGKQHFDKFDGSSLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGG
ILITPLPGATDTKPGSATRPFFGVQPALVDNMGNILEGENEGNLVLLDSWPGQMRTVYGD
HERFVLTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVSHE
LVAEAAVVGYPHDIKGQGIYAYVTLTRGTEETEELRQELRQWVRKEIGALATPDLIQWAT
GLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIESRLNRTE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcagtctctctacaaagtctccggcaatatcgctgccaatgcacttgtaaac
aacgataaatataaaacaatgtaccaagagtcgattgtcaatcctgaaggtttctggaga
gaacacggcaagcgtattgattggataaaaccctataccaaaattaaaaaaacctctttt
gatgatcataatttatcgatcaactggttttacgacggcaccctaaatgcttctgccaac
tgtttagatcgtcacttagccgagcacagtgatcgcgtggcgattatttgggaaggcgac
aacgccagcgaacaacgcaaaatcacctacggtgaattacatgcagatgtgtgtaaattc
gccaacgcattacgcagccaaggcgtgcgccgcggtgacatagtcacaatttacatgcct
atggtgccagaagccgcagtggctatgctcgcctgtgcccgtatcggcgcggtgcactct
gtggtcttcggtggtttctcaccggattctatcgcctctcgcgtcattgatggcaaatca
aaagtcattattacctcagatgaaggtatgcgcggtggccgtgctatcccactgaaacgc
aacatcgatgatgccttaaaaaatcctgatgtcactaccgttgaaaaagtcatcgtgctt
aaacgcacgggtggcaaagtggattgggtagaaggccgagatgtgtggtggcactcactg
atggaaaccgcatctgagtactgtcaaccagaggaaatggacgcagaagcgccgttattc
ctgctgtatacctcaggttcaaccggtaaccccaagggcgtattgcacaccactggtggc
tacatggtttatgcgtctatgacccatgagtatgtgttcgactacaaagcgggcgaagtg
tactggtgtaccgccgatgtgggttggatcacaggccactcttatatggtttacggccca
ctcgccaatggtgcgactgtgcttatccatgaaggcgtaccgaatcatccaagccctgcc
cgtttaggcgaaatgattgaccgccataaagtgagcattctttacacagcgccaacctta
attcgcgcgctgatggccgaaggtaagcaacacttcgataagttcgatggtagcagcttg
aggatcatgggctcggtaggcgaacccatcaacccagaagcatggcgttggtaccatgag
gtcataggtcatgaacattgccctatcgtcgatacttggtggcaaactgaaactggcggt
attttgatcacgccactgcctggggcgaccgacactaaacctggttcagcaacccgtccg
ttctttggtgttcaacccgccttagtcgataacatgggtaatattttagaaggtgagaac
gaaggtaacttagtgttactcgactcttggccgggccaaatgcgaactgtgtatggcgac
cacgaacgattcgtactgacctattttaaaactttccgcggcatgtattttaccggtgac
ggtgcccgccgcgatgaagatggctactactggataacaggccgcgtcgatgacgtaatc
aacgtatccggccacagattaggtacggcagaggtcgaaagtgcgctggtatcacatgaa
ctggttgcagaagcggcagtagttggctacccacacgatattaaaggccaaggtatttat
gcgtacgtcacgctaacccgcggcactgaagaaaccgaagagctacgtcaagagctgcgt
caatgggtgcgtaaagaaattggtgcgctggcaaccccagatcttatccaatgggcaacg
ggcttacctaagacacgttcgggcaagatcatgcgccgcttcctgcgtaagattgccgct
aacgaagtgaccaacttaggggatgcatcaaccttggccgatccagcggtgatcgagacc
ttgattgaatcacgcttgaatcgtactgagtaa

DBGET integrated database retrieval system