KEGG   Shewanella baltica OS117: Sbal117_1963Help
Entry
Sbal117_1963      CDS       T02013                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
sbs  Shewanella baltica OS117
Brite
Enzymes [BR:sbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Sbal117_1963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(2247162..2248187)
Genome map
AA seq 341 aa AA seqDB search
MSLELLQAAALNLKKAVPLMLKHKIPTTPVNYALWYTYVGEQNPELNQRLDTVIAQYNTC
PPVSSELLYRQYVADPVELDVREMRQNLDAMVTERSQSLKDTNLDANEFQSRIESNFEKL
NRIEDEGFSVEQVLDLVRSLVKESDNIRSSTEFFTGQLQKAQTEIDALKKKLEQTEKDVL
YDALTGCFNRRAFDSDFAGMLAQAPLGTSLILADIDHFKVFNDTYGHQLGDQVLRAVAKR
LQESCRDGAKLYRFGGEEFVIIVPKSQLRIARQLAEAMRRGLEKLSLKDRRKDERINNIS
ASFGVAQWQEKQTGMQLIEAADKLLYDAKRLGRNRVLPISN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctagagttattacaagccgctgcactgaatctcaaaaaagcagtgcctctgatg
ctcaaacataaaattccgaccaccccggttaactatgcgctttggtacacttatgttggt
gaacagaatcctgaattaaatcaacgactcgataccgttatcgcccagtacaacacttgt
cctcctgtgagtagcgaactcttatatcgccagtatgttgccgatcccgttgaactcgat
gtccgcgaaatgcgccagaatctggatgctatggtgactgagcggtcccaatcgctcaaa
gataccaatctggatgccaatgaattccagtcgcgcatcgagagtaattttgaaaagctc
aaccgcatcgaagatgagggttttagtgttgagcaagtgctcgatctggtgcgcagttta
gtgaaagagtcggacaatattcgctcgagcactgagttctttaccggacaattgcagaaa
gcgcaaaccgaaatcgatgcgctaaagaaaaagctcgaacagacagaaaaagatgtgctc
tacgatgcgctgactggctgctttaatcgccgcgccttcgacagcgattttgccggcatg
ttggcccaagcgcccttaggcaccagcttgatcttggccgatatcgaccattttaaagtg
tttaacgacacctacggccaccagctcggcgaccaagtgttacgcgccgtggcgaaacgg
ctgcaggaatcctgccgcgatggcgcgaaactgtatcgttttggcggtgaagaatttgtg
attattgtgcctaaaagtcagttacgcatcgcaaggcaactggccgaagccatgcgccgt
ggactcgaaaagctcagtttgaaagacagacgtaaagacgagcgcatcaataatatcagt
gcctcatttggggttgcccaatggcaagaaaaacaaacgggcatgcaattaattgaagcg
gcagataaattactttatgacgctaaacgtttaggtcgaaatcgcgtgttaccgatcagc
aactaa

DBGET integrated database retrieval system