KEGG   Shewanella baltica OS117: Sbal117_2358Help
Entry
Sbal117_2358      CDS       T02013                                 

Definition
(GenBank) Aspartate transaminase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00220  Arginine biosynthesis
sbs00250  Alanine, aspartate and glutamate metabolism
sbs00290  Valine, leucine and isoleucine biosynthesis
sbs01100  Metabolic pathways
sbs01110  Biosynthesis of secondary metabolites
sbs01130  Biosynthesis of antibiotics
sbs01210  2-Oxocarboxylic acid metabolism
sbs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sbal117_2358
   00290 Valine, leucine and isoleucine biosynthesis
    Sbal117_2358
   00220 Arginine biosynthesis
    Sbal117_2358
Enzymes [BR:sbs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Sbal117_2358
    2.6.1.66  valine---pyruvate transaminase
     Sbal117_2358
Amino acid related enzymes [BR:sbs01007]
 Aminotransferase (transaminase)
  Class I
   Sbal117_2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AEH14079
Position
2682142..2683356
Genome map
AA seq 404 aa AA seqDB search
MRPIIKSNKLDSVCYDIRGPVHKEARRLEDEGHRILKLNIGNPAPFGFEAPEEIVRDVIL
NLPSAQGYCESKGLFSARKAIVQHYQAQGIFGVDIEDIYIGNGVSELIMMAMQGLLNTDD
EILIPSPDYPLWTAAANLAGGKAVHYRCDEEADWFPDLNDIKSKISSRTRGIVLINPNNP
TGAVYSKELLLQVVELCREHSLILFADEIYDKILYDEAKHVPAAGLSDDILTVTFNGLSK
AYRAAGFRVGWMMLSGNLKAAKSYIEGLEMLSSMRLCANVPNQHAIQTALGGYQSINELI
LPKGRLTVQRDACYELLNQIPGVSVKKPKGALYAFPKLDMKKFNLRDDERLVLDLLREKK
ILLVHGTAFNWPEPDHLRVVFLPYKEDLKKAFTEFGAFLENYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcctatcatcaaatccaacaagctggatagcgtttgctatgacatccgcggccca
gtgcacaaggaagccagacgtttagaagacgagggtcatcggatcctcaaacttaacatt
ggtaatcccgcccccttcggtttcgaagcgccggaggaaattgtgcgcgatgtgatcctt
aatctacccagtgcccaaggctactgtgagtcaaaaggattattctctgcccgcaaggcc
atagtgcagcattatcaagctcaggggatttttggtgtcgatatcgaagatatctatata
ggcaacggcgtctctgaactcattatgatggcgatgcaaggtttgcttaacaccgatgat
gaaattttaatcccctcgcctgactatccactgtggacggcggcggccaatctcgccggc
ggtaaagcggtgcattatcgttgcgatgaagaagcggactggttccccgatctcaacgac
attaaaagcaaaatttcatcgcgtacccgcggtattgtgctgatcaacccgaacaatcct
acgggcgcggtttacagcaaagaattactgctgcaagttgttgagctttgccgtgaacac
agtttgattttatttgccgatgaaatttacgacaaaattttgtatgacgaagccaagcat
gttcctgcggctggcctgtcggacgatattttaactgttaccttcaatggtctatcaaag
gcttatcgcgcagcgggatttcgcgtcggttggatgatgttgtctggcaatcttaaagcc
gcgaagagctatatcgaaggtttagagatgctctcttcgatgcgcctgtgtgcaaacgtg
cccaatcaacatgcgattcaaaccgcgctcggcggctatcaaagtattaacgagctaatt
ttacctaagggtcgcctgacagttcaacgggatgcctgttacgagctgttgaatcaaatc
ccgggcgtcagcgttaaaaagcctaagggcgcactgtatgctttccctaaactggatatg
aaaaaattcaatctgcgggatgatgagcgcttagtgctggatttactcagagaaaagaaa
attctgttagtgcacggcaccgcctttaattggcctgagcccgaccatttacgagtggtt
ttcttaccctataaagaagatctgaaaaaagcatttaccgagtttggcgccttcctcgaa
aactatcggcagtag

DBGET integrated database retrieval system