KEGG   Shewanella baltica OS117: Sbal117_2650Help
Entry
Sbal117_2650      CDS       T02013                                 

Definition
(RefSeq) succinyl-CoA ligase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sbs  Shewanella baltica OS117
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal117_2650
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal117_2650
   00640 Propanoate metabolism
    Sbal117_2650
   00660 C5-Branched dibasic acid metabolism
    Sbal117_2650
Enzymes [BR:sbs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sbal117_2650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(3032544..3033710)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKSLFAEYGLPVSEGFACDTAQEAVEAAGHIGGNLWVVKCQVHAGGRGKAGGV
KVTGDKEEIRAFAEHWLGKNLVTYQTDEKGQPVAKILVESCTDIANELYLGAVVDRATRR
VVFMASTEGGVEIEKVAEETPELIHTAIIDPLTGPQGYQARDLGFKLGLNPTQMKQFTKI
FMGLATMFVDHDFALLEINPLVITTEGNLHCLDGKIGIDGNALYRQPKIKGMHDPSQDDA
REAHAAKFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGTNAELGREV
LAKSGLDIIAATSLTDAAEQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaatccttatttgccgaatatggtttaccagtgtca
gaaggttttgcatgtgatacagcccaagaagctgtagaagcggcaggccatattggcgga
aatttatgggttgttaagtgtcaagtacacgctggcggccgcggtaaagcgggtggcgtt
aaagtcactggcgataaagaagaaatcagagcctttgccgaacactggttaggcaaaaat
ctggtgacttatcaaactgatgagaaaggtcagccagttgctaaaattttagtagaaagc
tgcaccgacatcgctaacgaactgtacctaggtgccgttgttgaccgcgcgactcgtcgc
gtagtgttcatggcgtcgactgaaggtggtgttgaaattgagaaagtggcagaagaaacg
ccagaactcatccacactgcaatcatcgatcctttgactggtccacaaggttatcaagca
cgtgatcttggcttcaagttaggtttaaacccaactcaaatgaagcagttcactaagatt
ttcatgggtctggcgactatgttcgttgatcatgatttcgcattgcttgaaatcaaccca
ctggttattaccactgaaggcaacctacactgcctagacggtaaaatcggtatcgacggt
aacgcactttatcgtcaaccaaaaatcaaaggtatgcacgatccatcacaggatgatgcc
cgcgaagctcacgctgctaagttcgaactgaactatgtagcgttagacggtaacgttggc
tgtatggtgaacggtgcaggtctggctatgggtactatggatatcgttaacttgcacggt
ggcaagccagcgaacttcctagacgtaggcggcggcgcgactaaagaacgtgtagcagaa
gctttcaaaatcattctgtctgacagcaatgtgaaagcggttctggttaacattttcggc
ggtatcgtacgttgtgacatgatcgcagaaggtattatcggcgctgttaaagaagtcggc
gttaaagtacctgttgtagttcgtttagaaggtactaacgctgaacttggccgtgaagta
ttagctaaatcaggtcttgatatcattgcagctaccagtctgactgacgcggctgagcaa
gttgttaaagctgcggagggcaaataa

DBGET integrated database retrieval system