KEGG   Shewanella baltica OS117: Sbal117_2655Help
Entry
Sbal117_2655      CDS       T02013                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sbs  Shewanella baltica OS117
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal117_2655
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal117_2655
   00650 Butanoate metabolism
    Sbal117_2655
  Energy metabolism
   00190 Oxidative phosphorylation
    Sbal117_2655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3040570..3040917)
Genome map
AA seq 115 aa AA seqDB search
MVTNAASFGRSGVHDYILLRASAVILACYTIFLVGFIACSSPLTYDVWHSLFSALPMKVF
TLLALVALLVHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgcagcaagttttggacgcagtggtgttcatgactatattctactacgc
gctagtgcagtgatcctcgcctgttacaccattttcttggttggctttattgcatgtagt
tcccctctcacctacgacgtgtggcatagcctttttagcgctctgccgatgaaagtgttt
acacttctggcgctggtcgcattattggtacacgcttggattggtgtatggcaagtgctg
acagattacgtcaagtgcacgtcgttacgtggtgttttacagttcacctttgtcgttacc
gtattttgttatttagcggccggcattgttattgtgtggggtgtctaa

DBGET integrated database retrieval system