KEGG   Shewanella baltica OS117: Sbal117_2670Help
Entry
Sbal117_2670      CDS       T02013                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sbs  Shewanella baltica OS117
Brite
Enzymes [BR:sbs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Sbal117_2670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3059672..3060706
Genome map
AA seq 344 aa AA seqDB search
MTKLTSIAIFIAGIFASAHAISAEPIEVIKAVKVTEPEKVELGKMLFFEPRLSKSGYISC
NSCHNLATGGVDALPTSVGHNWQQGPINSPTVLNANYMLAQFWDGRASDLQAQAAGPIEN
PKEMGYSHALATQTIASMPAYRAHFAKVYGDENVTIDRLTDAISTFEKTLVTPNSPFDQY
LLGKQDAISVDAKAGYQLFKSKGCVSCHNGPAVGGTMYMKMGLIKPFHTNNPAKGRIAVT
GKEADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLSDKENLEMVAFL
VSLTGDQPQITLPILPPSNKNTPRPVPFSHDPMSSKPVSDELLK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactcacatctattgctattttcattgcgggtattttcgccagtgcccatgcc
atcagtgctgaacccatcgaagtgataaaagcggtgaaagtcactgaaccggagaaagtt
gaactcggtaaaatgctgttcttcgaaccaaggctatccaaatcgggctacatctcctgt
aactcttgccacaatttagccactggcggagtcgatgccctaccaacctctgttggccat
aattggcaacaaggcccgattaactcgcccacagtgctcaatgccaattatatgctggcg
caattttgggatggccgcgccagtgatttacaagcgcaagccgctggccctatcgagaat
cctaaggaaatgggctatagccatgcactcgcgacacaaactattgcctctatgccggcc
tatcgggcgcattttgccaaagtctatggcgatgaaaacgtcacgattgaccgcttaacc
gatgcgatttccacctttgaaaaaaccttagtcacgccaaatagtccgttcgatcaatat
ttattgggtaagcaagatgcgatcagtgtggatgccaaagcgggttaccaactgtttaag
agcaaagggtgcgtaagctgccataacggtccagccgtcggtggcactatgtatatgaag
atgggattgattaaacctttccacaccaataatcccgccaaaggtcgtatcgcagtcaca
ggtaaagaagccgataagtttgtctttaaagtgccgacactgcgcaatattgaactcacc
tatccctacttccacgacggcagtgtctggaccttagaagaagcggtgaacactatggcc
gatattcaattaggccaaaaactgtcggacaaagaaaatctagaaatggtcgcctttctc
gtctcgttgacgggggatcaacctcagatcaccttgccgattttgccgccatccaacaag
aacacaccgcgcccagtaccttttagccatgatccaatgagtagcaagccagttagcgat
gagctattaaagtag

DBGET integrated database retrieval system