KEGG   Shewanella baltica OS117: Sbal117_2820Help
Entry
Sbal117_2820      CDS       T02013                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sbs  Shewanella baltica OS117
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sbs01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3248551..3249150
Genome map
AA seq 199 aa AA seqDB search
MAKTLGAFILLSVLTVTPAHAAKVLILGDSLGASYGMAEQSGWVALLQKNLPEHQFTNGS
VSGETTAGGLRRLPALLDSVAPDLVVVELGGNDGLRGFPPTQLENNLIQIITLAKDSGAK
VLLTEIMVPPNYGPRYTQKFTQVYQDISKTQDIVLIPFFMQDIAPHPELMQRDGIHPNEK
AQAQIATWMQPWIEDALTQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaccctgggggcattcatcctactgagtgtactcacggtcacgcccgctcac
gcagcaaaggtgttgatactcggcgacagcttaggcgctagctatggtatggcagagcag
tcaggctgggtggcgctgctgcaaaaaaatctgcccgaacatcaatttactaatggctca
gtgagcggcgaaaccaccgcgggcggcttacgccgattacccgccttactcgattccgtc
gcccccgaccttgtggtcgttgaactgggtggtaatgatggtttacgtggattcccccca
acgcaacttgaaaataatctaatccaaatcattaccctagccaaagatagcggcgcaaaa
gtgctgctgaccgagatcatggtaccgcctaactatggccctcgctacacccaaaagttc
acccaagtgtatcaagacatatccaaaacacaggatatcgtgttgatccccttctttatg
caggatatcgcgccccatccagaattaatgcagcgggatggcattcaccccaacgaaaag
gcgcaggcgcagatagcaacttggatgcaaccatggatagaagatgcgttaacccaataa

DBGET integrated database retrieval system