KEGG   Shewanella baltica OS117: Sbal117_2839Help
Entry
Sbal117_2839      CDS       T02013                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sbs  Shewanella baltica OS117
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sbal117_2839
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal117_2839
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sbal117_2839
Enzymes [BR:sbs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sbal117_2839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3270763..3271584
Genome map
AA seq 273 aa AA seqDB search
MSDTLTNTGRYQATFAKLKAEGRGAFVPFVTLGDPSPELSLKIIDTLVQNGADALELGFP
FSDPLADGPVIQGANLRSLAAGTTPTACFELLAQVRAKYPELPIGLLLYANLVFANGIDA
FYAKAQQAGVDSVLIADVPVEESAPFSEAAKAHGIAPIFIAPPNADSETLALVSASGEGY
TYLLSRAGVTGTDTKAGVPVEEILSKLKTFNAPPPLLGFGIAEPAQVSAAIKAGAAGAIS
GSAVVKIIETHQHDEAKLLATLGDFTRAMKAAT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatacattgactaacactggccgttaccaagccacctttgccaaactcaaagcc
gaaggccgtggtgcttttgtcccattcgtcacccttggcgaccctagccctgagttatcg
ctgaaaattatcgataccttagtgcaaaacggtgcagatgccttagaactgggctttccg
ttttccgatcccttggccgatggccctgtgatccaaggtgctaacctgcgttctttagct
gcgggcacgactccaacggcgtgttttgaattactggcgcaagtgcgtgctaaatatcct
gaactgccaatcggtttgctgctgtatgcgaacttggtgtttgctaatggcatagatgcg
ttttacgccaaagcgcagcaagcgggtgtggattcagtgcttattgccgacgtacccgtg
gaagaatcggcgccctttagcgaagcggctaaagcccatggtattgcgccaatttttatc
gcgccgcccaatgccgacagtgaaacccttgcactggttagcgccagcggtgaaggttac
acctatctcttatcccgcgcaggggtgacaggcacagacactaaagctggcgttccggtg
gaagaaattctatccaagttgaaaacttttaacgcgccgccaccgctactcggctttggc
attgccgaacccgctcaagtgagcgccgcaatcaaagcaggcgctgcaggggcaatttca
ggctctgctgtcgtgaaaatcatcgaaacccaccagcacgatgaagctaagctactggcg
acacttggcgattttactcgcgccatgaaagcggcgacctaa

DBGET integrated database retrieval system