KEGG   Shewanella baltica OS117: Sbal117_2839Help
Entry
Sbal117_2839      CDS       T02013                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sbs  Shewanella baltica OS117
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sbal117_2839
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal117_2839
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sbal117_2839
Enzymes [BR:sbs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sbal117_2839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3270763..3271584
Genome map
AA seq 273 aa AA seqDB search
MSDTLTNTGRYQATFAKLKAEGRGAFVPFVTLGDPSPELSLKIIDTLVQNGADALELGFP
FSDPLADGPVIQGANLRSLAAGTTPTACFELLAQVRAKYPELPIGLLLYANLVFANGIDA
FYAKAQQAGVDSVLIADVPVEESAPFSEAAKAHGIAPIFIAPPNADSETLALVSASGEGY
TYLLSRAGVTGTDTKAGVPVEEILSKLKTFNAPPPLLGFGIAEPAQVSAAIKAGAAGAIS
GSAVVKIIETHQHDEAKLLATLGDFTRAMKAAT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatacattgactaacactggccgttaccaagccacctttgccaaactcaaagcc
gaaggccgtggtgcttttgtcccattcgtcacccttggcgaccctagccctgagttatcg
ctgaaaattatcgataccttagtgcaaaacggtgcagatgccttagaactgggctttccg
ttttccgatcccttggccgatggccctgtgatccaaggtgctaacctgcgttctttagct
gcgggcacgactccaacggcgtgttttgaattactggcgcaagtgcgtgctaaatatcct
gaactgccaatcggtttgctgctgtatgcgaacttggtgtttgctaatggcatagatgcg
ttttacgccaaagcgcagcaagcgggtgtggattcagtgcttattgccgacgtacccgtg
gaagaatcggcgccctttagcgaagcggctaaagcccatggtattgcgccaatttttatc
gcgccgcccaatgccgacagtgaaacccttgcactggttagcgccagcggtgaaggttac
acctatctcttatcccgcgcaggggtgacaggcacagacactaaagctggcgttccggtg
gaagaaattctatccaagttgaaaacttttaacgcgccgccaccgctactcggctttggc
attgccgaacccgctcaagtgagcgccgcaatcaaagcaggcgctgcaggggcaatttca
ggctctgctgtcgtgaaaatcatcgaaacccaccagcacgatgaagctaagctactggcg
acacttggcgattttactcgcgccatgaaagcggcgacctaa

DBGET integrated database retrieval system