KEGG   Shewanella baltica OS117: Sbal117_2899Help
Entry
Sbal117_2899      CDS       T02013                                 

Definition
(GenBank) fatty acid oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00071  Fatty acid degradation
sbs00280  Valine, leucine and isoleucine degradation
sbs00281  Geraniol degradation
sbs00310  Lysine degradation
sbs00362  Benzoate degradation
sbs00380  Tryptophan metabolism
sbs00410  beta-Alanine metabolism
sbs00640  Propanoate metabolism
sbs00650  Butanoate metabolism
sbs00903  Limonene and pinene degradation
sbs00930  Caprolactam degradation
sbs01040  Biosynthesis of unsaturated fatty acids
sbs01100  Metabolic pathways
sbs01110  Biosynthesis of secondary metabolites
sbs01120  Microbial metabolism in diverse environments
sbs01130  Biosynthesis of antibiotics
sbs01200  Carbon metabolism
sbs01212  Fatty acid metabolism
Module
sbs_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sbal117_2899
   00650 Butanoate metabolism
    Sbal117_2899
  Lipid metabolism
   00071 Fatty acid degradation
    Sbal117_2899
   01040 Biosynthesis of unsaturated fatty acids
    Sbal117_2899
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sbal117_2899
   00310 Lysine degradation
    Sbal117_2899
   00380 Tryptophan metabolism
    Sbal117_2899
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sbal117_2899
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sbal117_2899
   00281 Geraniol degradation
    Sbal117_2899
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sbal117_2899
   00930 Caprolactam degradation
    Sbal117_2899
Enzymes [BR:sbs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sbal117_2899
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sbal117_2899
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sbal117_2899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 LEM
Motif
Other DBs
NCBI-ProteinID: AEH14591
Position
complement(3342783..3344903)
Genome map
AA seq 706 aa AA seqDB search
MEKTFNLTRRDDGIAILTMDVPGETMNTLKAQFGPEISEILADIKSDSSIRGLVLISGKK
DSFVAGADISMLDACKTAGDAKALSQQGHVVFNELEALTIPVVAAIHGACLGGGLELALA
CHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKM
GLVNDVVPQTILLQTAVEMALAGKRAPKPVKKSLVNQVLEGTSFGRNIIFDQATKQVEKK
TQGNYPAPAKIIDCVRQGITKGMQKGLEVEASHFAELVVSKESEALRSIFFATTEMKKET
GAEGASPRKVKKAVILGGGLMGGGIASVTTTKAKIPVRVKDISEKGLSNALAYAYKLLDK
GVKRRHMTPAARDNLMALMTTTTEYKGVKDADIVVEAVFEDLALKHQMVKDIERECGEHT
IFASNTSSLPISQIAEAATRPENVIGLHYFSPVEKMPLVEVIAHAKTSPETIATTVAFAR
KQGKTPIVVQDGAGFYVNRILALYMNEAAQLLLEGQSVEHLDKALVKFGFPVGPITLLDE
VGIDVGAKISPILEKELGERFKAPAAFDKLLGDDRKGRKNGKGFYQYGASSKKAKAVDES
VYGVLGIKPGTNKDAKALAERCVVQMLNEAVRCLDDGIIASPRDGDIGAIFGIGFPPFLG
GPFHYIDTLGAANLVRILEGYQSQLGSRFEPCERLKTMAQENAHFF
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagacctttaatttaacccgccgcgacgacggcattgccatcctgactatggat
gttcctggcgaaaccatgaacaccctaaaagcgcagtttggccctgaaatcagtgagatt
ctggccgatatcaaaagtgattcgagcattcgcggtttagtgctgatctcaggcaaaaaa
gattctttcgtcgcgggcgcagatatttctatgctcgatgcctgtaaaacggcgggcgat
gccaaagccttatcccagcaaggccacgtggttttcaatgagctagaagccttaacgatt
cctgtagttgccgcaatccatggtgcctgtttaggcggtggtttagagttagccttagct
tgtcatcaaagggtatgtagcgacgatggcaagactatgctcggcgtaccggaagttcaa
cttggcttattgccaggcggcggcgggactcaacgtttgccacgtttagtcggcattacc
accgccttagatatgatgttgaccggtaaacaaattcgtcctaaacaagccttgaaaatg
ggcttagtgaatgatgttgtgccgcagacgattctgttacaaaccgcagttgagatggcg
cttgcgggtaaacgtgcaccgaaaccagttaagaagtcactcgttaatcaagtgcttgaa
ggcacgagtttcggccgtaacattattttcgatcaagcgactaagcaggtcgaaaagaaa
acccaaggtaattatcctgcgcctgccaagatcattgactgcgtgcgtcaaggaattact
aagggcatgcaaaagggtttagaagtcgaagccagtcattttgccgaattagtggtatcg
aaagagtctgaagcgctgcgcagtattttcttcgcgaccacagaaatgaagaaagaaact
ggcgctgaaggtgcaagcccgcgtaaagtgaaaaaagcggtgatcttaggtggcggttta
atgggcggtggtatcgcatctgtgacgacgaccaaggccaaaatccccgttcgtgtcaaa
gacatcagcgaaaaaggtttaagcaatgcattagcttacgcctacaagctgttggataaa
ggggttaagcgccgtcatatgacgcctgctgcccgtgacaacttaatggcactgatgacc
acaacgactgaatataaaggcgttaaagatgccgacatcgttgtggaggcggtatttgaa
gatttagcgcttaagcatcaaatggtgaaagacattgagcgtgagtgtggtgagcacacc
atttttgcgtcaaacacctcatctttgcctattagccaaatcgccgaagcggcaacgcgt
cctgagaacgtgattggtctgcattatttctcgccagtagaaaaaatgccgctggtggaa
gtgattgcccatgctaaaacgtcaccagaaaccattgcgactactgtcgcatttgcccgt
aagcaaggtaaaacaccgatagtggtgcaagacggcgcgggtttctacgtgaaccgtatt
cttgcgctctacatgaacgaggccgcgcaattattacttgaaggccaaagtgttgaacat
cttgataaagcgctggttaagtttggtttccctgtgggccctattactttactcgacgaa
gtgggtatcgacgtgggcgctaagatttcaccaatcctcgaaaaagaattgggtgaacgt
tttaaagcgccagcggcttttgacaagcttttgggtgacgatcgtaaaggccgtaaaaat
ggtaaaggtttctatcaatacggcgcatcgagtaagaaagctaaagctgtcgatgagagt
gtttatggcgtgttaggtattaagccaggcaccaataaagacgcaaaagcacttgccgag
cgttgtgtcgtacaaatgctcaacgaagcggtgcgttgtttagatgatggtattatcgca
tcgccaagagatggtgatattggcgccattttcggtattggcttcccgccattcctcggt
ggtccattccattatattgacactttgggtgctgcgaacttagtgcgaattcttgaaggt
tatcaaagccaattgggtagcagattcgaaccttgtgagcgcttaaaaaccatggctcaa
gaaaacgcgcactttttctaa

DBGET integrated database retrieval system