KEGG   Shewanella baltica OS117: Sbal117_3362Help
Entry
Sbal117_3362      CDS       T02013                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sbs  Shewanella baltica OS117
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sbal117_3362
Enzymes [BR:sbs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Sbal117_3362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3875694..3877025)
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNGLALCSEEIQFFVQGITTNSVSEGQIAALGMAVYFNDMNMDERIALT
TAMRDSGTVLNWQSLELNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPSSELFRKVVKEVGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLACNLDALAMDVKVGSGAFMPTYEASEELARSIAAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAIDFLTGAYRNPRLYEVTMGLCAEMLLLGGLASNEADARAKL
NRVLDNGRAAELFGKMVSGLGGPADFVENYSKYLPQSQIIRPVFADMQGYAYSMDTRELG
LAVVTLGGGRRKPGDALDYSVGLTQVCALGDKVDSSTPIAVIHAQSEAAFAEAELAVKKA
IHIGETAPEKTPEIYAYIRASDL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagctcaagagattattcgtaaaaaacgtaatggtttagcgctctgttccgaa
gaaatacagttctttgtacaaggtatcaccaccaactctgtatctgaaggtcagatcgcc
gcattaggtatggcggtgtattttaatgacatgaatatggatgaaagaatcgctttaacg
acagcgatgcgagattcaggcactgtgcttaattggcaatcattggaactcaacggtcct
gtcatcgacaaacacagcactggtggtgtcggcgatgtgattagtctcatgcttggccct
atggctgcggcttgtggcggttatgtgcctatgatttctgggcgcggcctaggtcatact
ggcggtacactcgataagtttgatgccattccgggttaccaaactgagccttcaagtgaa
ttgttccgcaaagtggttaaagaagtcggggtggcgattattggccaaacgggcgatctc
gtccctgccgataaacgcttctattctattcgcgataataccgctaccgttgaatccatt
tccctcatcacagcgtcgattctgtctaagaaattagcctgtaatttagatgcgttggcg
atggacgtaaaagttggtagcggcgctttcatgccaacctatgaggcatcggaagaatta
gctcgcagtatcgccgccgttgcaaatggcgcgggtactaaaacgacggctttacttacc
gatatgaatcaagtgcttgcatcttgtgccggtaacgcggttgaagtgaaagaagccata
gactttttaacgggtgcttaccgtaacccgcgtttatatgaagtcactatgggtctttgt
gctgagatgctgctgcttggcggtcttgcaagcaatgaagccgatgctcgcgctaaactg
aatcgtgtactcgacaatggtcgcgccgcagagctctttggcaagatggtgtcgggtctt
ggtggtccagccgattttgttgaaaactacagtaaatacctgccgcagtcacaaattatt
cgtccggtttttgccgatatgcaaggttatgcctacagcatggatacccgtgagttaggt
ttagcggttgtgaccttaggtggcggccgtcgtaagcccggcgatgcactagactatagt
gttggcttaacccaagtgtgtgccctaggcgataaagtggattcatcgacgccaattgcg
gttatccatgcacagtctgaagccgcgttcgcagaagctgaacttgcggtgaaaaaagcg
attcacattggtgaaaccgctccagaaaaaacacctgagatctatgcctatattcgtgca
tcggatctttaa

DBGET integrated database retrieval system